KEGG   Homo sapiens (human): 638
Entry
638               CDS       T01001                                 
Symbol
BIK, BIP1, BP4, NBK
Name
(RefSeq) BCL2 interacting killer
  KO
K18452  Bcl-2-interacting killer
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    638 (BIK)
SSDB
Motif
Pfam: bcl-2I13 BID
Other DBs
NCBI-GeneID: 638
NCBI-ProteinID: NP_001188
OMIM: 603392
HGNC: 1051
Ensembl: ENSG00000100290
Vega: OTTHUMG00000150703
Pharos: Q13323(Tbio)
UniProt: Q13323 A0A024R4X6
LinkDB
Position
22:43110750..43129712
AA seq 160 aa
MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALR
LACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMR
FWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtctgaagtaagacccctctccagagacatcttgatggagaccctcctgtatgagcag
ctcctggaacccccgaccatggaggttcttggcatgactgactctgaagaggacctggac
cctatggaggacttcgattctttggaatgcatggagggcagtgacgcattggccctgcgg
ctggcctgcatcggggacgagatggacgtgagcctcagggccccgcgcctggcccagctc
tccgaggtggccatgcacagcctgggtctggctttcatctacgaccagactgaggacatc
agggatgttcttagaagtttcatggacggtttcaccacacttaaggagaacataatgagg
ttctggagatccccgaaccccgggtcctgggtgtcctgcgaacaggtgctgctggcgctg
ctgctgctgctggcgctgctgctgccgctgctcagcgggggcctgcacctgctgctcaag
tga

DBGET integrated database retrieval system