KEGG   Homo sapiens (human): 63928
Entry
63928             CDS       T01001                                 
Symbol
CHP2
Name
(RefSeq) calcineurin like EF-hand protein 2
  KO
K17611  calcineurin B homologous protein 2
Organism
hsa  Homo sapiens (human)
Drug target
Ciclosporin: D00184<JP/US>
Pimecrolimus: D05480<US>
Ruclosporin: D10983
Tacrolimus (DG00439): D00107<JP/US> D08556
Voclosporin: D09033<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    63928 (CHP2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     63928 (CHP2)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg RST Dockerin_1 EF-hand_9 TerB DIMCO_N
Other DBs
NCBI-GeneID: 63928
NCBI-ProteinID: NP_071380
HGNC: 24927
Ensembl: ENSG00000166869
Pharos: O43745(Tbio)
UniProt: O43745
Structure
LinkDB
Position
16:23755026..23758935
AA seq 196 aa
MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVN
PLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAF
QLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKS
LEKMDVEQKMSIRILK
NT seq 591 nt   +upstreamnt  +downstreamnt
atggggtcgcgcagctcccacgccgcggtcattcccgacggggacagtattcggcgagag
accggcttctcccaagccagcctgctccgcctgcaccaccggttccgggcactggacagg
aataagaagggctacctgagccgcatggatctccagcagataggggcgctcgccgtgaac
cccctgggagaccgaattatagaaagcttcttccccgatgggagccagcgagtggatttc
ccaggctttgtcagggtcttggctcattttcgccctgtagaagatgaggacacagaaacc
caagaccccaagaaacctgaacctctcaacagcagaaggaacaaacttcactatgcattt
cagctctatgacctggatcgcgatgggaagatctccaggcatgagatgctgcaggttctc
cgtctgatggttggggtacaggtgacagaagagcagctggagaacatcgctgaccgcacg
gtgcaggaggctgatgaagatggggatggggctgtgtccttcgtggagttcaccaagtcc
ttagagaagatggacgttgagcaaaaaatgagcatccggatcctgaagtga

DBGET integrated database retrieval system