KEGG   Homo sapiens (human): 6404
Entry
6404              CDS       T01001                                 
Symbol
SELPLG, CD162, CLA, PSGL-1, PSGL1
Name
(RefSeq) selectin P ligand
  KO
K06544  selectin P ligand
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04613  Neutrophil extracellular trap formation
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    6404 (SELPLG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    6404 (SELPLG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    6404 (SELPLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    6404 (SELPLG)
CD molecules [BR:hsa04090]
 Proteins
  6404 (SELPLG)
SSDB
Motif
Pfam: DUF4689
Other DBs
NCBI-GeneID: 6404
NCBI-ProteinID: NP_002997
OMIM: 600738
HGNC: 10722
Ensembl: ENSG00000110876
Pharos: Q14242(Tbio)
UniProt: Q14242
Structure
LinkDB
Position
12:complement(108621895..108633894)
AA seq 412 aa
MPLQLLLLLILLGPGNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPP
EMLRNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAME
IQTTQPAATEAQTTQPVPTEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATE
AQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQTTPPAAMEAQTTQTTAMEAQTTAPEATE
AQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSVSSVTHKGIPMAA
SNLSVNYPVGAPDHISVKQCLLAILILALVATIFFVCTVVLAVRLSRKGHMYPVRNYSPT
EMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSFLP
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgcctctgcaactcctcctgttgctgatcctactgggccctggcaacagcttgcagctg
tgggacacctgggcagatgaagccgagaaagccttgggtcccctgcttgcccgggaccgg
agacaggccaccgaatatgagtacctagattatgatttcctgccagaaacggagcctcca
gaaatgctgaggaacagcactgacaccactcctctgactgggcctggaacccctgagtct
accactgtggagcctgctgcaaggcgttctactggcctggatgcaggaggggcagtcaca
gagctgaccacggagctggccaacatggggaacctgtccacggattcagcagctatggag
atacagaccactcaaccagcagccacggaggcacagaccactcaaccagtgcccacggag
gcacagaccactccactggcagccacagaggcacagacaactcgactgacggccacggag
gcacagaccactccactggcagccacagaggcacagaccactccaccagcagccacggaa
gcacagaccactcaacccacaggcctggaggcacagaccactgcaccagcagccatggag
gcacagaccactgcaccagcagccatggaagcacagaccactccaccagcagccatggag
gcacagaccactcaaaccacagccatggaggcacagaccactgcaccagaagccacggag
gcacagaccactcaacccacagccacggaggcacagaccactccactggcagccatggag
gccctgtccacagaacccagtgccacagaggccctgtccatggaacctactaccaaaaga
ggtctgttcatacccttttctgtgtcctctgttactcacaagggcattcccatggcagcc
agcaatttgtccgtcaactacccagtgggggccccagaccacatctctgtgaagcagtgc
ctgctggccatcctaatcttggcgctggtggccactatcttcttcgtgtgcactgtggtg
ctggcggtccgcctctcccgcaagggccacatgtaccccgtgcgtaattactcccccacc
gagatggtctgcatctcatccctgttgcctgatgggggtgaggggccctctgccacagcc
aatgggggcctgtccaaggccaagagcccgggcctgacgccagagcccagggaggaccgt
gagggggatgacctcaccctgcacagcttcctcccttag

DBGET integrated database retrieval system