KEGG   Homo sapiens (human): 64145
Entry
64145             CDS       T01001                                 
Symbol
RBSN, Rabenosyn-5, ZFYVE20
Name
(RefSeq) rabenosyn, RAB effector
  KO
K12481  rabenosyn-5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    64145 (RBSN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    64145 (RBSN)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Others
   Others
    64145 (RBSN)
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    64145 (RBSN)
 Protein recycling
   Rab4 associated proteins
    64145 (RBSN)
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Rab associated proteins
    64145 (RBSN)
SSDB
Motif
Pfam: NPF Rbsn FYVE TerY_C zf-Di19 RNA_POL_M_15KD zinc_ribbon_9 HypA IBR
Other DBs
NCBI-GeneID: 64145
NCBI-ProteinID: NP_001289307
OMIM: 609511
HGNC: 20759
Ensembl: ENSG00000131381
Vega: OTTHUMG00000129860
Pharos: Q9H1K0(Tbio)
UniProt: Q9H1K0 A8K5H3
Structure
LinkDB
Position
3:complement(15070073..15099148)
AA seq 784 aa
MASLDDPGEVREGFLCPLCLKDLQSFYQLHSHYEEEHSGEDRDVKGQIKSLVQKAKKAKD
RLLKREGDDRAESGTQGYESFSYGGVDPYMWEPQELGAVRSHLSDFKKHRAARIDHYVVE
VNKLIIRLEKLTAFDRTNTESAKIRAIEKSVVPWVNDQDVPFCPDCGNKFSIRNRRHHCR
LCGSIMCKKCMELISLPLANKLTSASKESLSTHTSPSQSPNSVHGSRRGSISSMSSVSSV
LDEKDDDRIRCCTHCKDTLLKREQQIDEKEHTPDIVKLYEKLRLCMEKVDQKAPEYIRMA
ASLNAGETTYSLEHASDLRVEVQKVYELIDALSKKILTLGLNQDPPPHPSNLRLQRMIRY
SATLFVQEKLLGLMSLPTKEQFEELKKKRKEEMERKRAVERQAALESQRRLEERQSGLAS
RAANGEVASLRRGPAPLRKAEGWLPLSGGQGQSEDSDPLLQQIHNITSFIRQAKAAGRMD
EVRTLQENLRQLQDEYDQQQTEKAIELSRRQAEEEDLQREQLQMLRERELEREREQFRVA
SLHTRTRSLDFREIGPFQLEPSREPRTHLAYALDLGSSPVPSSTAPKTPSLSSTQPTRVW
SGPPAVGQERLPQSSMPQQHEGPSLNPFDEEDLSSPMEEATTGPPAAGVSLDPSARILKE
YNPFEEEDEEEEAVAGNPFIQPDSPAPNPFSEEDEHPQQRLSSPLVPGNPFEEPTCINPF
EMDSDSGPEAEEPIEEELLLQQIDNIKAYIFDAKQCGRLDEVEVLTENLRELKHTLAKQK
GGTD
NT seq 2355 nt   +upstreamnt  +downstreamnt
atggcttctctggacgacccaggggaagtgagggagggcttcctctgccctctgtgcctg
aaggatctgcagtctttctatcagcttcactcacattacgaggaagaacactcaggggaa
gaccgtgatgtcaaagggcaaattaaaagtcttgtccagaaggctaaaaaagcaaaggac
aggttgttgaaacgagaaggggatgatcgagcagagtcagggacccaaggatatgagtct
ttcagctatggaggggttgatccttacatgtgggaaccccaggagcttggtgctgtgaga
agccatctttccgacttcaaaaaacaccgagctgctagaattgaccactatgttgtggaa
gtcaataaactaataatcaggttagagaagctcactgcatttgacagaacaaatactgag
tctgcaaagattcgagcaatagaaaagtctgtggtgccttgggtcaacgaccaggatgtc
cctttctgtccagactgtgggaataagttcagcatccggaaccgccgccaccactgccgc
ctctgcgggtctattatgtgcaagaagtgtatggagctcatcagccttcccttggcaaac
aagctcaccagtgccagcaaggagtccctgagcacccacaccagccccagccagtcaccc
aacagtgtccatggctcccgccgaggcagcatcagcagcatgagcagtgtcagctcggtc
ctggatgagaaggacgatgaccggatccgctgctgtacacactgcaaggacacgctgctc
aagagagagcagcagattgatgagaaggagcacacacctgacatcgtgaagctctacgag
aaattacgactttgcatggagaaagttgaccagaaagctccagaatacatcaggatggca
gcatcattaaatgctggggagacaacctacagtctggaacatgccagtgaccttcgagtg
gaagtgcagaaagtgtatgagctgatagacgctttaagtaagaagatcttaaccttgggc
ttgaaccaggaccctccaccacatccaagcaatttgcggctgcagagaatgatcagatac
tcagctacactttttgtgcaggaaaagttgcttggtttgatgtcactgccaaccaaagaa
cagtttgaggaactgaaaaagaaaaggaaggaggaaatggagaggaagagggccgtggag
agacaagctgccctggagtcccagcgaaggcttgaggaaaggcagagtggcctggcttct
cgagcggccaacggggaggtggcatctctccgcaggggccctgcccccttgagaaaggct
gagggctggctcccactgtcaggaggtcaggggcagagtgaggactcagacccgctcctc
cagcagatccacaacatcacatcattcatcaggcaggccaaggccgcgggccgcatggat
gaagtgcgcactctgcaggagaacctgcggcagctgcaggacgagtatgaccagcagcag
acagagaaggccatcgagctgtcccggaggcaggctgaggaggaggacctgcagcgggaa
cagctgcagatgttgcgtgaacgggagttggaacgagaaagggagcagtttcgggtggca
tccctgcacacacggactcggtccctggacttcagagaaatcggcccttttcagctggag
cccagcagagagcctcgcacccaccttgcttatgctttggatctaggctcttccccagtt
ccaagcagcacagctcccaagaccccttcacttagctcaactcaacccaccagagtgtgg
tctgggcccccagccgttggccaggagcgcttaccccagagcagcatgccacagcaacat
gaggggccctccttaaacccctttgatgaggaagacctctccagccccatggaagaggcc
actactggtcctcctgctgcaggggtttccttagacccttcagcccgcatcctgaaagag
tacaatcctttcgaggaagaggacgaggaggaggaagcagtggcagggaatccattcatt
cagccagacagcccagctcctaaccccttcagtgaggaagacgaacatccccagcagagg
ctctcaagccctctggttcctggtaacccctttgaggaacccacctgtatcaaccccttt
gagatggacagtgacagtgggccagaggctgaggagcccatagaggaagagctcctcctg
cagcagatcgataacatcaaggcatacatctttgatgccaagcagtgcggccgcctggat
gaggtagaggtgctgacagagaatctgcgggagctgaagcacaccctggccaagcagaag
gggggcactgactga

DBGET integrated database retrieval system