KEGG   Homo sapiens (human): 64211
Entry
64211             CDS       T01001                                 
Symbol
LHX5
Name
(RefSeq) LIM homeobox 5
  KO
K18493  LIM homeobox protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    64211 (LHX5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    64211 (LHX5)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain LIM
    64211 (LHX5)
SSDB
Motif
Pfam: LIM Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 64211
NCBI-ProteinID: NP_071758
OMIM: 605992
HGNC: 14216
Ensembl: ENSG00000089116
Vega: OTTHUMG00000169552
Pharos: Q9H2C1(Tbio)
UniProt: Q9H2C1
LinkDB
Position
12:complement(113462033..113471871)
AA seq 402 aa
MMVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRF
GTKCAGCAQGISPSDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYL
SSSSLKEGSLNSVSSCTDRSLSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKR
RGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQ
LSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQGDYYAPGSNYDFFAHGP
PSQAQSPADSSFLAASGPGSTPLGALEPPLAGPHAADNPRFTDMISHPDTPSPEPGLPGT
LHPMPGEVFSGGPSPPFPMSGTSGYSGPLSHPNPELNEAAVW
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgatggtgcactgcgccggttgcgagcggcccatcctcgaccgctttctgctgaacgtg
ctggaccgcgcgtggcacatcaaatgtgttcagtgctgcgagtgcaaaaccaacctctcg
gagaagtgcttctcgcgcgagggcaagctctactgcaaaaatgactttttcaggcgcttt
ggcacgaaatgcgccggctgcgcgcaaggcatctcgcccagcgacctggtgcgcaaggcc
cggagcaaagtctttcacctcaactgtttcacctgcatggtgtgtaacaagcagctgtcc
accggcgaggagctctacgtcatcgacgagaacaagttcgtgtgcaaagacgactacctg
agctcatccagcctcaaggagggcagcctcaactcagtgtcatcctgtacggaccgcagt
ttgtccccggacctccaggacgcactgcaggacgaccccaaagagacggacaactcgacc
tcgtcggacaaggagacggccaacaacgagaacgaggagcagaactcgggcaccaagcgg
cgcggcccccgcaccaccatcaaggccaagcagctggagacgctcaaggctgccttcgcc
gccacgcccaagcccacgcgccacatccgcgagcagctggcgcaggagaccggcctcaac
atgcgcgtcatccaggtgtggtttcagaaccgacggtccaaagaacgccggatgaaacag
ctgagcgccctaggcgcccggaggcacgccttcttccggagtccgcggcgcatgcgtccg
ctgggcggccgcttggacgagtctgagatgttggggtccaccccgtacacctactacgga
gactaccaaggcgactactacgcgccgggaagcaactacgacttcttcgcgcacggcccg
ccttcgcaggcgcagtccccggccgactccagcttcctggcggcctctggccccggctcg
acgccgctgggagcgctggaaccgccgctcgccggcccgcacgccgcggacaaccccagg
ttcaccgacatgatctcgcacccggacacaccgagccccgagccaggcctgccgggcacg
ctgcaccccatgcccggcgaggtattcagcggcgggcccagcccgcccttcccaatgagc
ggcaccagcggctacagcggacccctgtcgcatcccaaccccgagctcaacgaagccgcc
gtgtggtaa

DBGET integrated database retrieval system