KEGG   Homo sapiens (human): 64398
Entry
64398             CDS       T01001                                 

Gene name
PALS1, MPP5
Definition
(RefSeq) protein associated with LIN7 1, MAGUK family member
  KO
K06091  MAGUK p55 subfamily member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa05165  Human papillomavirus infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06166  Human papillomavirus (HPV)
  Element
N00344  CRB3-Pals1-PATJ complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    64398 (PALS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    64398 (PALS1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    64398 (PALS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    64398 (PALS1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 PDZ domain-containing proteins
  MAGUK family proteins
   64398 (PALS1)
SSDB
Motif
Pfam: Guanylate_kin L27_N PDZ SH3_2 PDZ_6 L27 SH3_1 PDZ_2 SH3_9 APC1_C
Other DBs
NCBI-GeneID: 64398
NCBI-ProteinID: NP_071919
OMIM: 606958
HGNC: 18669
Ensembl: ENSG00000072415
Vega: OTTHUMG00000171243
Pharos: Q8N3R9(Tbio)
UniProt: Q8N3R9 Q658X5
LinkDB
Structure
PDB: 
4UU5 4UU6 4WSI 1Y76

Position
14q23.3
AA seq 675 aa
MTTSHMNGHVTEESDSEVKNVDLASPEEHQKHREMAVDCPGDLGTRMMPIRRSAQLERIR
QQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVK
ILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPF
PLISNAQDLAQEVQTVLKPVHHKEGQELTALLNTPHIQALLLAHDKVAEQEMQLEPITDE
RVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDE
VLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSD
DPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMK
QTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKR
PIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADI
AAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPP
SQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLIN
KLDTEPQWVPSTWLR
NT seq 2028 nt   +upstreamnt  +downstreamnt
atgacaacatcccatatgaatgggcatgttacagaggaatcagacagcgaagtaaaaaat
gttgatcttgcatcaccagaggaacatcagaagcaccgagagatggctgttgactgccct
ggagatttgggcaccaggatgatgccaatacgtcgaagtgcacagttggagcgtattcgg
caacaacaggaggacatgaggcgtaggagagaggaagaagggaaaaagcaagaacttgac
cttaattcttccatgagacttaagaaactagcccaaattcctccaaagaccggaatagat
aaccctatgtttgatacagaggaaggaattgtcttagaaagtcctcattatgctgtgaaa
atattagaaatagaagacttgttttcttcacttaaacatatccaacatactttggtagat
tctcagagccaggaggatatttcactgcttttacaacttgttcaaaataaggatttccag
aatgcatttaagatacacaatgccatcacagtacacatgaacaaggccagtcctccattt
cctcttatctccaacgcacaagatcttgctcaagaggtacaaactgttttgaagccagtt
catcataaggaaggacaagaactaactgctttgctgaatactccacatattcaggcactt
ttactggcccacgataaggttgctgagcaggaaatgcagctagagcccattacagatgag
agagtttatgaaagtattggccagtatggaggagaaactgtaaaaatagttcgtatagaa
aaggctcgtgatattccgttgggtgctacagttcgtaatgaaatggactctgtcatcatt
agccggatagtaaaagggggtgctgcagagaaaagtggtctgttgcatgaaggagatgaa
gttctagagattaatggcattgaaattcgggggaaagatgtcaatgaggtttttgacttg
ttgtctgatatgcatggtactttgacttttgtcctgattcccagtcaacagatcaagccg
cctcctgccaaggaaacagtaatccatgtaaaagctcattttgactatgacccctcagat
gacccttatgttccatgtcgagagttaggtctgtcttttcaaaaaggtgatatacttcat
gtgatcagtcaagaagatccaaactggtggcaggcctacagggaaggggacgaagataat
caacctctagccgggcttgttccagggaaaagctttcagcagcaaagggaagccatgaaa
caaaccatagaagaagataaggagccagaaaaatcaggaaaactgtggtgtgcaaagaag
aataaaaagaagaggaaaaaggttttatataatgccaataaaaatgatgattatgacaac
gaggagatcttaacctatgaggaaatgtcactttatcatcagccagcaaataggaagaga
cctatcatcttgattggtccacagaactgtggccagaatgaattgcgtcagaggctcatg
aacaaagaaaaggaccgctttgcatctgcagttcctcatacaacccggagtaggcgagac
caagaagtagccggtagagattaccactttgtttcgcggcaagcattcgaggcagacata
gcagctggaaagttcattgagcatggtgaatttgagaagaatttgtatggaactagcata
gattctgtacggcaagtgatcaactctggcaaaatatgtcttttaagtcttcgtacacag
tcattgaagactctccggaattcagatttgaaaccatatattatcttcattgcaccccct
tcacaagaaagacttcgggcattattggccaaagaaggcaagaatccaaagcctgaagag
ttgagagaaatcattgagaagacaagagagatggagcagaacaatggccactactttgat
acggcaattgtgaattccgatcttgataaagcctatcaggaattgcttaggttaattaac
aaacttgatactgaacctcagtgggtaccatccacttggctgaggtga

DBGET integrated database retrieval system