KEGG   Homo sapiens (human): 6452
Entry
6452              CDS       T01001                                 
Symbol
SH3BP2, 3BP-2, 3BP2, CRBM, CRPM, RES4-23
Name
(RefSeq) SH3 domain binding protein 2
  KO
K07984  SH3-domain binding protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
Disease
H00497  Cherubism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    6452 (SH3BP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    6452 (SH3BP2)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Src homology (SH) domain-containing proteins
  SH3 domain binding proteins
   6452 (SH3BP2)
SSDB
Motif
Pfam: PH SH2 PH_6 PH_11
Other DBs
NCBI-GeneID: 6452
NCBI-ProteinID: NP_001116153
OMIM: 602104
HGNC: 10825
Ensembl: ENSG00000087266
Vega: OTTHUMG00000160801
Pharos: P78314(Tbio)
UniProt: P78314 A0A384N6E5
Structure
LinkDB
Position
4:2793085..2841096
AA seq 561 aa
MAAEEMHWPVPMKAIGAQNLLTMPGGVAKAGYLHKKGGTQLQLLKWPLRFVIIHKRCVYY
FKSSTSASPQGAFSLSGYNRVMRAAEETTSNNVFPFKIIHISKKHRTWFFSASSEEERKS
WMALLRREIGHFHEKKDLPLDTSDSSSDTDSFYGAVERPVDISLSPYPTDNEDYEHDDED
DSYLEPDSPEPGRLEDALMHPPAYPPPPVPTPRKPAFSDMPRAHSFTSKGPGPLLPPPPP
KHGLPDVGLAAEDSKRDPLCPRRAEPCPRVPATPRRMSDPPLSTMPTAPGLRKPPCFRES
ASPSPEPWTPGHGACSTSSAAIMATATSRNCDKLKSFHLSPRGPPTSEPPPVPANKPKFL
KIAEEDPPREAAMPGLFVPPVAPRPPALKLPVPEAMARPAVLPRPEKPQLPHLQRSPPDG
QSFRSFSFEKPRQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEP
QDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHT
HVLPSHQSLLLRHPYGYTGPR
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggcggctgaagagatgcattggcctgtccctatgaaggccattggtgcccagaacctg
ctaaccatgcctgggggcgtggccaaggctggctacctgcacaagaagggcggtacccag
ctgcagctgctgaaatggcccctgcgctttgtcatcatccacaaacgctgcgtctactac
ttcaagagtagcacctctgcctccccgcagggcgccttctccctgagtggctataaccgg
gtgatgcgggcggctgaggagaccacgtccaacaacgttttccccttcaagatcatccat
atcagcaagaagcaccgcacgtggttcttctcggcctcctccgaggaggagcgcaagagc
tggatggccttgctgcgcagggagattggccacttccacgaaaagaaagacctgcccttg
gacaccagcgactccagctcggacacagacagcttctacggcgcagttgagcggcctgtg
gatatcagcctttccccgtaccccacggacaatgaagactatgagcacgacgatgaggat
gactcctacctggagcctgactccccggagcccggaaggcttgaggatgccctgatgcac
ccaccggcttacccaccacccccagtgcccacgcccaggaagccagccttctctgacatg
ccccgggcccactcctttacctccaagggccccggtcccctactgccacccccgccccct
aagcacggcctcccagatgttggcctggctgctgaggactccaagagggacccactgtgc
ccgaggcgggctgagccttgccccagggtacctgctaccccccgaaggatgagcgatccc
cctctgagcaccatgcccaccgcacccggcctccggaaacccccttgcttccgggagagt
gccagccccagcccggagccctggacccctggccacggggcctgctccacttccagtgct
gccatcatggccactgccacctccagaaactgtgacaaactcaagtccttccacctgtcc
ccccgaggaccacccacatctgagcccccacctgtgccagccaacaagcccaagttcctg
aagatagctgaagaggaccccccaagggaggcagccatgcccggactctttgtgcccccc
gtggctccccggcctcctgcgctgaagctgccagtgcctgaggccatggcgcggcccgca
gtcctgcccaggccagagaagccgcagctcccgcacctccagcgatcaccccccgatggg
cagagtttcaggagcttctcctttgaaaagccccggcaaccctcacaggctgacactggc
ggggacgactcggacgaggactatgagaaggtgccactgcccaactcggtcttcgtcaac
accacggagtcctgcgaagtggaaaggttgttcaaggctacaagcccccggggagagccc
caggatggactctactgcatccggaactcctctaccaagtcggggaaggtcctggttgtg
tgggacgaaacctctaacaaagtgaggaactatcgcatttttgagaaggactctaagttc
tacctggagggcgaggtcctgtttgtgagtgtgggcagcatggtggagcactaccacacc
cacgtgctgcccagccaccagagcctgctgctgcggcacccctacggctacactgggcct
aggtga

DBGET integrated database retrieval system