KEGG   Homo sapiens (human): 6498
Entry
6498              CDS       T01001                                 
Symbol
SKIL, SNO, SnoA, SnoI, SnoN
Name
(RefSeq) SKI like proto-oncogene
  KO
K18499  Ski-like protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    6498 (SKIL)
SSDB
Motif
Pfam: Ski_Sno c-SKI_SMAD_bind DUF489
Other DBs
NCBI-GeneID: 6498
NCBI-ProteinID: NP_001234937
OMIM: 165340
HGNC: 10897
Ensembl: ENSG00000136603
Vega: OTTHUMG00000158831
Pharos: P12757(Tbio)
UniProt: P12757
Structure
LinkDB
Position
3:170357715..170396849
AA seq 684 aa
MENLQTNFSLVQGSTKKLNGMGDDGSPPAKKMITDIHANGKTINKVPTVKKEHLDDYGEA
PVETDGEHVKRTCTSVPETLHLNPSLKHTLAQFHLSSQSSLGGPAAFSARHSQESMSPTV
FLPLPSPQVLPGPLLIPSDSSTELTQTVLEGESISCFQVGGEKRLCLPQVLNSVLREFTL
QQINTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFP
QNGSVLPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAP
QTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRSG
KRNQSKTDAPSGMELQSWYPVIKQEGDHVSQTHSFLHPSYYLYMCDKVVAPNVSLTSAVS
QSKELTKTEASKSISRQSEKAHSSGKLQKTVSYPDVSLEEQEKMDLKTSRELCSRLDASI
SNNSTSKRKSESATCNLVRDINKVGIGLVAAASSPLLVKDVICEDDKGKIMEEVMRTYLK
QQEKLNLILQKKQQLQMEVKMLSSSKSMKELTEEQQNLQKELESLQNEHAQRMEEFYVEQ
KDLEKKLEQIMKQKCTCDSNLEKDKEAEYAGQLAELRQRLDHAEADRQELQDELRQEREA
RQKLEMMIKELKLQILKSSKTAKE
NT seq 2055 nt   +upstreamnt  +downstreamnt
atggaaaacctccagacaaatttctccttggttcagggctcaactaaaaaactgaatggg
atgggagatgatggcagccccccagcgaaaaaaatgataacggacattcatgcaaatgga
aaaacgataaacaaggtgccaacagttaagaaggaacacttggatgactatggagaagca
ccagtggaaactgatggagagcatgttaagcgaacctgtacttctgttcctgaaactttg
catttaaatcccagtttgaaacacacattggcacaattccatttaagtagtcagagctcg
ctgggtggaccagcagcattttctgctcggcattcccaagaaagcatgtcgcctactgta
tttctgcctcttccatcacctcaggttcttcctggcccattgctcatcccttcagatagc
tccacagaactcactcagactgtgttggaaggggaatctatttcttgttttcaagttgga
ggagaaaagagactctgtttgccccaagtcttaaattctgttctccgagaatttacactc
cagcaaataaatacagtgtgtgatgaactgtacatatattgttcaaggtgtacttcagac
cagcttcatatcttaaaggtactgggcatacttccattcaatgccccatcctgtgggctg
attacattaactgatgcacaaagattatgtaatgctttattgcggccacgaacttttcct
caaaatggtagcgtacttcctgctaaaagctcattggcccagttaaaggaaactggcagt
gcctttgaagtggagcatgaatgcctaggcaaatgtcagggtttatttgcaccccagttt
tatgttcagcctgatgctccgtgtattcaatgtctggagtgttgtggaatgtttgcaccc
cagacgtttgtgatgcattctcacagatcacctgacaaaagaacttgccactggggcttt
gaatcagctaaatggcattgctatcttcatgtgaaccaaaaatacttaggaacacctgaa
gaaaagaaactgaagataattttagaagaaatgaaggagaagtttagcatgagaagtgga
aagagaaatcaatccaagacagatgcaccatcaggaatggaattacagtcatggtatcct
gttataaagcaggaaggtgaccatgtttctcagacacattcatttttacaccccagctac
tacttatacatgtgtgataaagtggttgccccaaatgtgtcacttacttctgctgtatcc
cagtctaaagagctcacaaagacagaggcaagtaagtccatatcaagacagtcagagaag
gctcacagtagtggtaaacttcaaaaaacagtgtcttatccagatgtctcacttgaggaa
caggagaaaatggatttaaaaacaagtagagaattatgtagccgtttagatgcatcaatc
tcaaataattctacaagtaaaaggaaatctgagtctgccacttgcaacttagtcagagac
ataaacaaagtgggaattggccttgttgctgccgcttcatctccgcttcttgtgaaagat
gtcatttgtgaggatgataagggaaaaatcatggaagaagtaatgagaacttatttaaaa
caacaggaaaaactaaacttgattttgcaaaagaagcaacaacttcagatggaagtaaaa
atgttgagtagttcaaaatctatgaaggaactcactgaagaacagcagaatttacagaaa
gagcttgaatctttgcagaatgaacatgctcaaagaatggaagaattttatgttgaacag
aaagacttagagaaaaaattggagcagataatgaagcaaaaatgtacctgtgactcaaat
ttagaaaaagacaaagaggctgaatatgcaggacagttggcagaactgaggcagagattg
gaccatgctgaggccgataggcaagaactccaagatgaactcagacaggaacgggaagca
agacagaagttagagatgatgataaaagagctaaagctgcaaattctgaaatcatcaaag
actgctaaagaatag

DBGET integrated database retrieval system