KEGG   Homo sapiens (human): 65264
Entry
65264             CDS       T01001                                 
Symbol
UBE2Z, HOYS7, USE1
Name
(RefSeq) ubiquitin conjugating enzyme E2 Z
  KO
K10585  ubiquitin-conjugating enzyme E2 Z [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    65264 (UBE2Z)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    65264 (UBE2Z)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     65264 (UBE2Z)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   65264 (UBE2Z)
SSDB
Motif
Pfam: UQ_con UEV RWD UFC1
Other DBs
NCBI-GeneID: 65264
NCBI-ProteinID: NP_075567
OMIM: 611362
HGNC: 25847
Ensembl: ENSG00000159202
Pharos: Q9H832(Tdark)
UniProt: Q9H832
Structure
LinkDB
Position
17:48908407..48929056
AA seq 354 aa
MAESPTEEAATAGAGAAGPGASSVAGVVGVSGSGGGFGPPFLPDVWAAAAAAGGAGGPGS
GLAPLPGLPPSAAAHGAALLSHWDPTLSSDWDGERTAPQCLLRIKRDIMSIYKEPPPGMF
VVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPN
FYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNY
NECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDP
FGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggcggagagtccgactgaggaggcggcaacggcgggcgccggggcggcgggccccggg
gcgagcagcgttgctggtgttgttggcgttagcggcagcggcggcgggttcgggccgcct
ttcctgccggatgtgtgggcggcggcggcggcagcgggcggggccgggggcccggggagc
ggcctggctccgctgcccgggctcccgccctcagccgctgcccacggggccgcgctgctt
agccactgggaccccacgctcagctccgactgggacggcgagcgcaccgcgccgcagtgt
ctactccggatcaagcgggatatcatgtccatttataaggagcctcctccaggaatgttc
gttgtacctgatactgttgacatgactaagattcatgcattgatcacaggcccatttgac
actccttatgaagggggtttcttcctgttcgtgtttcggtgtccgcccgactatcccatc
cacccacctcgggtcaaactgatgacaacgggcaataacacagtgaggtttaaccccaac
ttctaccgcaatgggaaagtctgcttgagtattctaggtacatggactggacctgcctgg
agcccagcccagagcatctcctcagtgctcatctctatccagtccctgatgactgagaac
ccctatcacaatgagcccggctttgaacaggagagacatccaggagacagcaaaaactat
aatgaatgtatccggcacgagaccatcagagttgcagtctgtgacatgatggaaggaaag
tgtccctgtcctgaacccctacgaggggtgatggagaagtcctttctggagtattacgac
ttctacgaggtggcctgcaaagatcgcctgcaccttcaaggccaaactatgcaggaccct
tttggagagaagcggggccactttgactaccagtccctcttgatgcgcctgggactgata
cgtcagaaagtgctggagaggctccataatgagaatgcagaaatggactctgatagcagt
tcatctgggacagagacagaccttcatgggagcctgagggtttag

DBGET integrated database retrieval system