KEGG   Homo sapiens (human): 653509
Entry
653509            CDS       T01001                                 
Symbol
SFTPA1, COLEC4, ILD1, PSAP, PSP-A, PSPA, SFTP1, SFTPA1B, SP-A, SP-A1, SP-A1_beta, SP-A1_delta, SP-A1_epsilon, SP-A1_gamma, SPA, SPA1
Name
(RefSeq) surfactant protein A1
  KO
K10067  pulmonary surfactant-associated protein A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa05133  Pertussis
Disease
H01299  Idiopathic pulmonary fibrosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    653509 (SFTPA1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    653509 (SFTPA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    653509 (SFTPA1)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    653509 (SFTPA1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    653509 (SFTPA1)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 3: Collectins
   653509 (SFTPA1)
SSDB
Motif
Pfam: Lectin_C Collagen
Other DBs
NCBI-GeneID: 653509
NCBI-ProteinID: NP_001158116
OMIM: 178630
HGNC: 10798
Ensembl: ENSG00000122852
Pharos: Q8IWL2(Tbio)
UniProt: Q8IWL2 A0A024QZP2
LinkDB
Position
10:79610939..79615455
AA seq 248 aa
MWLCPLALNLILMAASGAVCEVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPM
GPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQ
TRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKK
YNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLY
SRLTICEF
NT seq 747 nt   +upstreamnt  +downstreamnt
atgtggctgtgccctctggccctcaacctcatcttgatggcagcctctggtgctgtgtgc
gaagtgaaggacgtttgtgttggaagccctggtatccccggcactcctggatcccacggc
ctgccaggcagggacgggagagatggtctcaaaggagaccctggccctccaggccccatg
ggtccacctggagaaatgccatgtcctcctggaaatgatgggctgcctggagcccctggt
atccctggagagtgtggagagaagggggagcctggcgagaggggccctccagggcttcca
gctcatctagatgaggagctccaagccacactccacgactttagacatcaaatcctgcag
acaaggggagccctcagtctgcagggctccataatgacagtaggagagaaggtcttctcc
agcaatgggcagtccatcacttttgatgccattcaggaggcatgtgccagagcaggcggc
cgcattgctgtcccaaggaatccagaggaaaatgaggccattgcaagcttcgtgaagaag
tacaacacatatgcctatgtaggcctgactgagggtcccagccctggagacttccgctac
tcagacgggacccctgtaaactacaccaactggtaccgaggggagcccgcaggtcgggga
aaagagcagtgtgtggagatgtacacagatgggcagtggaatgacaggaactgcctgtac
tcccgactgaccatctgtgagttctga

DBGET integrated database retrieval system