KEGG   Homo sapiens (human): 6567
Entry
6567              CDS       T01001                                 
Symbol
SLC16A2, AHDS, DXS128, DXS128E, MCT_7, MCT_8, MCT7, MCT8, MRX22, XPCT
Name
(RefSeq) solute carrier family 16 member 2
  KO
K08231  MFS transporter, MCT family, solute carrier family 16 (monocarboxylic acid transporters), member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
Network
nt06322  TRH-TSH-TH signaling
  Element
N00798  Thyroid hormone signaling pathway
N00799  Mutation-inactivated THRA to thyroid hormone signaling pathway
N00800  Mutation-inactivated THRB to thyroid hormone signaling pathway
N00801  Mutation-inactivated SLC16A2 to thyroid hormone signaling pathway
Disease
H00650  Allan-Herndon-Dudley syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    6567 (SLC16A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6567 (SLC16A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC16: Monocarboxylate transporter
   6567 (SLC16A2)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Monocarboxylate transporter (MCT) family [TC:2.A.1.13]
    6567 (SLC16A2)
SSDB
Motif
Pfam: MFS_1 Trypan_PARP
Other DBs
NCBI-GeneID: 6567
NCBI-ProteinID: NP_006508
OMIM: 300095
HGNC: 10923
Ensembl: ENSG00000147100
Pharos: P36021(Tbio)
UniProt: P36021
LinkDB
Position
X:74421493..74533916
AA seq 539 aa
MALQSQASEEAKGPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPPPEPQPEPQPLPD
PAPLPELEFESERVHEPEPTPTVETRGTARGFQPPEGGFGWVVVFAATWCNGSIFGIHNS
VGILYSMLLEEEKEKNRQVEFQAAWVGALAMGMIFFCSPIVSIFTDRLGCRITATAGAAV
AFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQPSLVILGHYFQRRLGLANGVVSAGSS
IFSMSFPFLIRMLGDKIKLAQTFQVLSTFMFVLMLLSLTYRPLLPSSQDTPSKRGVRTLH
QRFLAQLRKYFNMRVFRQRTYRIWAFGIAAAALGYFVPYVHLMKYVEEEFSEIKETWVLL
VCIGATSGLGRLVSGHISDSIPGLKKIYLQVLSFLLLGLMSMMIPLCRDFGGLIVVCLFL
GLCDGFFITIMAPIAFELVGPMQASQAIGYLLGMMALPMIAGPPIAGLLRNCFGDYHVAF
YFAGVPPIIGAVILFFVPLMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggcgctgcaaagccaggcgagcgaggaagcaaaggggccctggcaggaggcagaccag
gaacagcaggagccggtgggtagcccagagccggagtctgagccggagcctgagcccgag
cccgagcccgtgccagtgcccccgcccgagccccagccggagccccagcccctaccggac
cccgcacccctgccggagctggagttcgagtccgagcgggtgcacgaacccgagcccacg
cctacggtagagacccgcggcaccgcgcgcggcttccagcctcccgaaggtggcttcggc
tgggtggtggtgttcgctgccacctggtgcaacggctccatcttcggcatccataactct
gtcgggatcctctactccatgctgctagaggaggaaaaggaaaaaaatcgccaagtggag
ttccaagcagcatgggtcggagccctcgcgatgggtatgatcttcttctgttctcccatt
gtgagtatattcactgaccgtttgggctgccgaatcacagcaaccgcgggggctgccgtt
gctttcattggcctccataccagctccttcaccagctccctaagcctgcgctacttcacc
tacgggattctctttggttgtggctgttccttcgcctttcagccatccctcgtcatcctg
ggccactactttcaacgccgcctgggtctggccaatggtgtggtgtctgctgggagtagc
attttctccatgtccttccccttcctcatcagaatgctgggggataagatcaagctggcc
caaaccttccaggtgctgagtaccttcatgtttgttcttatgctgctttcactcacctac
cggcccctcctgcccagctcccaggacaccccaagcaagagaggtgtccgcaccctgcac
cagcgctttctggctcagctcaggaagtacttcaacatgcgagtgttccgccaacgcact
taccgcatctgggccttcggaattgctgctgctgcccttggctactttgttccctatgta
cacctgatgaagtatgtggaggaggagttctcagaaatcaaggagacctgggtgctcttg
gtgtgtattggggctacctcaggccttgggcgtcttgtgtcaggccacatcagtgactcc
atccctggacttaagaagatctacttgcaggtcctttccttcctgctcctgggcctgatg
tccatgatgattcccctgtgccgggacttcgggggccttatcgtcgtctgtcttttcctg
ggcctttgcgatggcttcttcatcaccatcatggcccccattgcatttgagctggtgggc
ccaatgcaggcctcacaggccattggctacctcctgggcatgatggccctgccaatgatt
gctgggccccccattgcaggcctactccgcaactgttttggggactaccatgtggccttc
tactttgccggtgtgccccccatcatcggggctgtaatcctcttcttcgtccctctgatg
catcaaaggatgttcaagaaagagcagagagattccagcaaggataagatgttggcccct
gacccagaccccaatggggagctactgccgggctcccccaaccctgaggaaccaatctaa

DBGET integrated database retrieval system