KEGG   Homo sapiens (human): 6723
Entry
6723              CDS       T01001                                 
Symbol
SRM, PAPT, SPDSY, SPS1, SRML1
Name
(RefSeq) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa00330  Arginine and proline metabolism
hsa00480  Glutathione metabolism
hsa01100  Metabolic pathways
Module
hsa_M00034  Methionine salvage pathway
hsa_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    6723 (SRM)
   00330 Arginine and proline metabolism
    6723 (SRM)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    6723 (SRM)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     6723 (SRM)
SSDB
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_31 Methyltransf_25 Methyltransf_30
Other DBs
NCBI-GeneID: 6723
NCBI-ProteinID: NP_003123
OMIM: 182891
HGNC: 11296
Ensembl: ENSG00000116649
Vega: OTTHUMG00000002119
Pharos: P19623(Tchem)
UniProt: P19623
Structure
LinkDB
Position
1:complement(11054589..11060018)
AA seq 302 aa
MEPGPDGPAASGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYG
NVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESV
VQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGP
AESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPT
YPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALND
VS
NT seq 909 nt   +upstreamnt  +downstreamnt
atggagcccggccccgacggccccgccgcctccggccccgccgccatccgcgagggctgg
ttccgcgagacctgcagcctgtggcccggccaggccctgtcactgcaggtggagcagctg
ctccaccaccggcgctcgcgctaccaggacatcctcgtcttccgcagtaagacctatggc
aacgtgctggtgttggacggtgtcatccagtgcacggagagagacgagttctcctaccag
gagatgatcgccaacctgcctctctgcagccaccccaacccgcgaaaggtgctgatcatc
gggggcggagatggaggtgtcctgcgggaggtggtgaagcacccctccgtggagtccgtg
gtccagtgtgagatcgacgaggatgtcatccaagtctccaagaagttcctgccaggcatg
gccattggctactctagctcgaagctgaccctacatgtgggtgacggttttgagttcatg
aaacagaatcaggatgccttcgacgtgatcatcactgactcctcagaccccatgggcccc
gccgaaagtctcttcaaggagtcctattaccagctcatgaagacagccctcaaggaagat
ggtgtcctctgctgccagggcgagtgccagtggctgcacctggacctcatcaaggagatg
cggcagttctgccagtccctgttccccgtggtggcctatgcctactgcaccatccccacc
taccccagcggccagatcggcttcatgctgtgcagcaagaacccgagcacgaacttccag
gagccggtgcagccgctgacacagcagcaggtggcgcagatgcagctgaagtactacaac
tccgacgtgcaccgcgccgcctttgtgctgcccgagtttgcccgcaaggccctgaatgat
gtgagctga

DBGET integrated database retrieval system