KEGG   Homo sapiens (human): 6728
Entry
6728              CDS       T01001                                 

Gene name
SRP19
Definition
(RefSeq) signal recognition particle 19
  KO
K03105  signal recognition particle subunit SRP19
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    6728 (SRP19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hsa02044]
    6728 (SRP19)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   6728 (SRP19)
SSDB
Motif
Pfam: SRP19
Other DBs
NCBI-GeneID: 6728
NCBI-ProteinID: NP_003126
OMIM: 182175
HGNC: 11300
Ensembl: ENSG00000153037
Vega: OTTHUMG00000186064
Pharos: P09132(Tbio)
UniProt: P09132
LinkDB
Structure
PDB: 

Position
5q22.2
AA seq 144 aa
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNV
FLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQ
KTGGADQSLQQGEGSKKGKGKKKK
NT seq 435 nt   +upstreamnt  +downstreamnt
atggcttgcgctgccgcgcggtccccggccgaccaggacaggtttatttgtatctatcct
gcttatttaaataataagaagaccatcgcagagggaaggcgaatccccataagtaaggct
gttgaaaatcctacagctacagagattcaagatgtatgttcagcagttggacttaacgta
tttcttgagaaaaataaaatgtactctagagaatggaatcgtgatgtccaatacagaggc
agagtccgggtccagctcaaacaggaagatgggagcctctgccttgtacagttcccatca
cgtaagtcagtaatgttgtatgcagcagaaatgatacctaaactaaaaacaaggacacaa
aaaacaggaggtgctgaccaaagtcttcaacaaggagagggaagtaaaaaagggaaagga
aagaaaaagaagtaa

DBGET integrated database retrieval system