KEGG   Homo sapiens (human): 6730
Entry
6730              CDS       T01001                                 

Gene name
SRP68
Definition
(RefSeq) signal recognition particle 68
  KO
K03107  signal recognition particle subunit SRP68
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    6730 (SRP68)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hsa02044]
    6730 (SRP68)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   6730 (SRP68)
SSDB
Motif
Pfam: SRP68 TPR_6
Other DBs
NCBI-GeneID: 6730
NCBI-ProteinID: NP_055045
OMIM: 604858
HGNC: 11302
Ensembl: ENSG00000167881
Vega: OTTHUMG00000180054
Pharos: Q9UHB9(Tbio)
UniProt: Q9UHB9
LinkDB
Structure
PDB: 
5M72 5WRV 4P3F 5M73 4P3E

Position
17q25.1
AA seq 627 aa
MAAEKQVPGGGGGGGSGGGGGSGGGGSGGGRGAGGEENKENERPSAGSKANKEFGDSLSL
EILQIIKESQQQHGLRHGDFQRYRGYCSRRQRRLRKTLNFKMGNRHKFTGKKVTEELLTD
NRYLLLVLMDAERAWSYAMQLKQEANTEPRKRFHLLSRLRKAVKHAEELERLCESNRVDA
KTKLEAQAYTAYLSGMLRFEHQEWKAAIEAFNKCKTIYEKLASAFTEEQAVLYNQRVEEI
SPNIRYCAYNIGDQSAINELMQMRLRSGGTEGLLAEKLEALITQTRAKQAATMSEVEWRG
RTVPVKIDKVRIFLLGLADNEAAIVQAESEETKERLFESMLSECRDAIQVVREELKPDQK
QRDYILEGEPGKVSNLQYLHSYLTYIKLSTAIKRNENMAKGLQRALLQQQPEDDSKRSPR
PQDLIRLYDIILQNLVELLQLPGLEEDKAFQKEIGLKTLVFKAYRCFFIAQSYVLVKKWS
EALVLYDRVLKYANEVNSDAGAFKNSLKDLPDVQELITQVRSEKCSLQAAAILDANDAHQ
TETSSSQVKDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAF
PPLEDKLEQKTKSGLTGYIKGIFGFRS
NT seq 1884 nt   +upstreamnt  +downstreamnt
atggctgctgagaagcaggtcccaggcggcggcggcggcggcggcagtggcggcggcggt
ggcagtggcggcggcggtagcggcggtggacgtggtgccggaggggaagaaaataaagaa
aacgaacgcccttcggccggatcgaaggcaaacaaagaatttggggatagcctgagtttg
gagattcttcagattattaaggaatcccagcagcagcatggtttacggcatggagatttt
cagaggtacaggggctactgttcccgtagacaaagacgtcttcgaaaaacactcaacttc
aagatgggtaacagacacaaattcacagggaagaaagtgactgaagagcttctgaccgat
aatagatacttgcttctggttctgatggatgctgaaagagcctggagctacgccatgcag
ctgaaacaggaagccaacactgaaccccgaaaacggtttcacttgttatctcgcctacgc
aaagccgtgaagcatgcagaggaattggaacgcttgtgtgagagcaatcgcgtggatgcc
aagaccaaattagaggctcaggcttacacagcttacctctcaggaatgctacgttttgaa
catcaagaatggaaagctgccattgaggcttttaacaaatgcaaaactatctatgagaag
ctagccagtgctttcacagaggagcaggctgtgctgtataaccaacgtgtggaagagatt
tcacccaacatccgctattgtgcatataatattggggaccagtcagccatcaatgaactc
atgcagatgagattgaggtctgggggcactgagggtctcttggctgaaaaattggaggct
ttgatcactcagactcgagccaaacaggcagctaccatgagtgaagtggagtggagaggg
agaacggttccagtgaagattgacaaagtgcgcattttcttattaggactggctgataac
gaagcagctattgtccaggctgaaagcgaagaaactaaggagcgcctgtttgaatcaatg
ctcagcgagtgtcgggacgccatccaggtggttcgggaggagctcaagccagatcagaaa
cagagagattatatccttgaaggagagccagggaaggtgtctaatcttcaatacttgcat
agctacctgacttacatcaagctatcaacggcaatcaagcgtaatgagaacatggccaaa
ggtctgcagagggctctgctgcagcagcagccagaggatgacagcaagcgctcaccccgg
ccccaggacctgatccgactctatgacatcatcttacagaatctggtggaattgctccag
cttcctggtttagaggaagacaaagccttccagaaagagataggcctcaagactctggtg
ttcaaagcttacaggtgttttttcattgctcagtcctatgtgctggtgaagaagtggagc
gaagcccttgtcctgtatgacagagtcctgaaatatgcaaatgaagtaaattctgatgct
ggcgccttcaagaacagcctaaaggacctgcctgatgtgcaagagctcatcactcaagtg
cggtcagagaagtgctccctgcaggccgcagccatccttgatgcaaacgacgctcatcaa
acagagacctcctcctcccaagtcaaggacaataagcctctggttgaacggtttgagaca
ttctgcctggacccttcccttgtcaccaagcaagccaaccttgtgcacttcccaccaggc
ttccagcccattccctgcaagcctttgttctttgacctggccctcaaccatgtggctttc
ccaccccttgaggacaagttggaacagaagaccaagagtggcctcactggatacatcaag
ggcatctttggattcaggagctaa

DBGET integrated database retrieval system