KEGG   Homo sapiens (human): 6737
Entry
6737              CDS       T01001                                 

Symbol
TRIM21, RNF81, RO52, Ro/SSA, SSA, SSA1
Name
(RefSeq) tripartite motif containing 21
  KO
K10651  tripartite motif-containing protein 21 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    6737 (TRIM21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    6737 (TRIM21)
   04131 Membrane trafficking [BR:hsa04131]
    6737 (TRIM21)
   04121 Ubiquitin system [BR:hsa04121]
    6737 (TRIM21)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     6737 (TRIM21)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     6737 (TRIM21)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    6737 (TRIM21)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    6737 (TRIM21)
SSDB
Motif
Pfam: PRY SPRY zf-C3HC4_4 zf-C3HC4 zf-RING_UBOX zf-RING_2 zf-C3HC4_2 zf-C3HC4_3 zf-B_box zf-RING_6 zf-RING_5 zf-Nse zf-RING_4 zf-RING_10 zf-rbx1 U-box Prok-RING_4 DUF313 zf-UDP DZR_2 zf-ANAPC11 zf-RING_11
Other DBs
NCBI-GeneID: 6737
NCBI-ProteinID: NP_003132
OMIM: 109092
HGNC: 11312
Ensembl: ENSG00000132109
Vega: OTTHUMG00000165701
Pharos: P19474(Tbio)
UniProt: P19474
LinkDB
Structure
PDB: 
5OLM 2IWG 6S53 6FGA 5JPX

Position
11p15.4
AA seq 475 aa
MASAARLTMMWEEVTCPICLDPFVEPVSIECGHSFCQECISQVGKGGGSVCPVCRQRFLL
KNLRPNRQLANMVNNLKEISQEAREGTQGERCAVHGERLHLFCEKDGKALCWVCAQSRKH
RDHAMVPLEEAAQEYQEKLQVALGELRRKQELAEKLEVEIAIKRADWKKTVETQKSRIHA
EFVQQKNFLVEEEQRQLQELEKDEREQLRILGEKEAKLAQQSQALQELISELDRRCHSSA
LELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKKMLRTCAVHITLDPDTANPWL
ILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTGKEAWDLGVCR
DSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSF
YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQGSTDY
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcttcagcagcacgcttgacaatgatgtgggaggaggtcacatgccctatctgcctg
gaccccttcgtggagcctgtgagcatcgagtgtggccacagcttctgccaggaatgcatc
tctcaggttgggaaaggtgggggcagcgtctgtcctgtgtgccggcagcgctttctgctc
aagaatctccggcccaatcgacagctagccaacatggtgaacaaccttaaagaaatcagc
caggaggccagagagggcacacagggggaacggtgtgcagtgcatggagagagacttcac
ctgttctgtgagaaagatgggaaggccctttgctgggtatgtgcccagtctcggaaacac
cgtgaccacgccatggtccctcttgaggaggctgcacaggagtaccaggagaagctccag
gtggcattaggggaactgagaagaaagcaggagttggctgagaagttggaagtggaaatt
gcaataaagagagcagactggaagaaaacagtggaaacacagaaatctaggattcacgca
gagtttgtgcagcaaaaaaacttcctggttgaagaagaacagaggcagctgcaggagctg
gagaaggatgagagggagcagctgagaatcctgggggagaaagaggccaagctggcccag
cagagccaggccctacaggagctcatctcagagctagatcgaaggtgccacagctcagca
ctggaactgctgcaggaggtgataattgtcctggaaaggagtgagtcctggaacctgaag
gacctggatattacctctccagaactcaggagtgtgtgccatgtgccagggctgaagaag
atgctgaggacatgtgcagtccacatcactctggatccagacacagccaatccgtggctg
atactttcagaagatcggagacaagtgaggcttggagacacccagcagagcatacctgga
aatgaagagagatttgatagttatcctatggtcctgggtgcccagcactttcactctgga
aaacattactgggaggtagatgtgacaggaaaggaggcctgggacctgggtgtctgcaga
gactctgtgcgcaggaaggggcactttttgcttagttccaagagtggcttctggacaatt
tggttgtggaacaaacaaaaatatgaggctggcacctacccccagactcccctccacctt
caggtgcctccatgccaagttgggattttcctggactatgaggctggcatggtctccttc
tacaacatcactgaccatggctccctcatctactccttctctgaatgtgcctttacagga
cctctgcggcccttcttcagtcctggtttcaatgatggaggaaaaaacacagcccctcta
accctctgtccactgaatattggatcacaaggatccactgactattga

KEGG   Homo sapiens (human): 6738
Entry
6738              CDS       T01001                                 

Symbol
RO60, RORNP, SSA2, TROVE2
Name
(RefSeq) Ro60, Y RNA binding protein
  KO
K11089  60 kDa SS-A/Ro ribonucleoprotein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    6738 (RO60)
SSDB
Motif
Pfam: TROVE DUF2201 VWA_2 VWA_CoxE
Other DBs
NCBI-GeneID: 6738
NCBI-ProteinID: NP_001166995
OMIM: 600063
HGNC: 11313
Ensembl: ENSG00000116747
Vega: OTTHUMG00000035675
Pharos: P10155(Tbio)
UniProt: P10155 A0A024R983
LinkDB
Position
1q31.2
AA seq 538 aa
MEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEA
LIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCR
IPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHK
DLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRD
ELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSE
VSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKT
FKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMV
PCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPA
IALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTLDMI
NT seq 1617 nt   +upstreamnt  +downstreamnt
atggaggaatctgtaaaccaaatgcagccactgaatgagaagcagatagccaattctcag
gatggatatgtatggcaagtcactgacatgaatcgactacaccggttcttatgtttcggt
tctgaaggtgggacttattatatcaaagaacagaagttgggccttgaaaatgctgaagct
ttaattagattgattgaagatggcagaggatgtgaagtgatacaagaaataaagtcattt
agtcaagaaggcagaaccacaaagcaagagcctatgctctttgcacttgccatttgttcc
cagtgctccgacataagcacaaaacaagcagcatttaaagctgtttctgaagtttgtcgc
attcctacccatctctttacttttatccagtttaagaaagatctgaaggaaagcatgaaa
tgtggcatgtggggtcgtgccctccggaaggctatagcggactggtacaatgagaaaggt
ggcatggcccttgctctggcagttacaaaatataaacagagaaatggctggtctcacaaa
gatctattaagattgtcacatcttaaaccttccagtgaaggacttgcaattgtgaccaaa
tatattacaaagggctggaaagaagttcatgaattgtataaagaaaaagcactctctgtg
gagactgaaaaattattaaagtatctggaggctgtagagaaagtgaagcgcacaagagat
gagctagaagtcattcatctaatagaagaacatagattagttagagaacatcttttaaca
aatcacttaaagtctaaagaggtatggaaggctttgttacaagaaatgccgcttactgca
ttactaaggaatctaggaaagatgactgctaattcagtacttgaaccaggaaattcagaa
gtatctttagtatgtgaaaaactgtgtaatgaaaaactattaaaaaaggctcgtatacat
ccatttcatattttgatcgcattagaaacttacaagacaggtcatggtctcagagggaaa
ctgaagtggcgccctgatgaagaaattttgaaagcattggatgctgctttttataaaaca
tttaagacagttgaaccaactggaaaacgtttcttactagctgttgatgtcagtgcttct
atgaaccaaagagttttgggtagtatactcaacgctagtacagttgctgcagcaatgtgc
atggttgtcacacgaacagaaaaagattcttatgtagttgctttttccgatgaaatggta
ccatgtccagtgactacagatatgaccttacaacaggttttaatggctatgagtcagatc
ccagcaggtggaactgattgctctcttccaatgatctgggctcagaagacaaacacacct
gctgatgtcttcattgtattcactgataatgagacctttgctggaggtgtccatcctgct
attgctctgagggagtatcgaaagaaaatggatattccagctaaattgattgtttgtgga
atgacatcaaatggtttcaccattgcagacccagatgatagaggcatgttggatatgtgc
ggctttgatactggagctctggatgtaattcgaaatttcacattagatatgatttaa

DBGET integrated database retrieval system