KEGG   Homo sapiens (human): 6756
Entry
6756              CDS       T01001                                 

Symbol
SSX1, CT5.1, SSRC
Name
(RefSeq) SSX family member 1
  KO
K15624  protein SSX1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00142  SYT-SSX fusion to transcriptional repression
Disease
H00050  Synovial sarcoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    6756 (SSX1)
SSDB
Motif
Pfam: SSXRD KRAB
Other DBs
NCBI-GeneID: 6756
NCBI-ProteinID: NP_001265620
OMIM: 312820
HGNC: 11335
Ensembl: ENSG00000126752
Vega: OTTHUMG00000021488
Pharos: Q16384(Tbio)
UniProt: Q16384
LinkDB
Position
Xp11.23
AA seq 188 aa
MNGDDTFAKRPRDDAKASEKRSKAFDDIATYFSKKEWKKMKYSEKISYVYMKRNYKAMTK
LGFKVTLPPFMCNKQATDFQGNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDE
NDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRGKHAWTHRLRERKQLVIYEEI
SDPEEDDE
NT seq 567 nt   +upstreamnt  +downstreamnt
atgaacggagacgacacctttgcaaagagacccagggatgatgctaaagcatcagagaag
agaagcaaggcctttgatgatattgccacatacttctctaagaaagagtggaaaaagatg
aaatactcggagaaaatcagctatgtgtatatgaagagaaactataaggccatgactaaa
ctaggtttcaaagtcaccctcccacctttcatgtgtaataaacaggccacagacttccag
gggaatgattttgataatgaccataaccgcaggattcaggttgaacatcctcagatgact
ttcggcaggctccacagaatcatcccgaagatcatgcccaagaagccagcagaggacgaa
aatgattcgaagggagtgtcagaagcatctggcccacaaaacgatgggaaacaactgcac
cccccaggaaaagcaaatatttctgagaagattaataagagatctggacccaaaaggggg
aaacatgcctggacccacagactgcgtgagagaaagcagctggtgatttatgaagagatc
agtgaccctgaggaagatgacgagtaa

DBGET integrated database retrieval system