KEGG   Homo sapiens (human): 6846
Entry
6846              CDS       T01001                                 
Symbol
XCL2, SCM-1b, SCM1B, SCYC2
Name
(RefSeq) X-C motif chemokine ligand 2
  KO
K22675  C motif chemokine 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01258  XCL to XCR1 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6846 (XCL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6846 (XCL2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6846 (XCL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6846 (XCL2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6846 (XCL2)
SSDB
Motif
Pfam: IL8 PHtD_u1
Other DBs
NCBI-GeneID: 6846
NCBI-ProteinID: NP_003166
OMIM: 604828
HGNC: 10646
Ensembl: ENSG00000143185
Pharos: Q9UBD3(Tbio)
UniProt: Q9UBD3
LinkDB
Position
1:complement(168540768..168543997)
AA seq 114 aa
MRLLILALLGICSLTAYIVEGVGSEVSHRRTCVSLTTQRLPVSRIKTYTITEGSLRAVIF
ITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
NT seq 345 nt   +upstreamnt  +downstreamnt
atgagacttctcatcctggccctccttggcatctgctctctcactgcatacattgtggaa
ggtgtagggagtgaagtctcacataggaggacctgtgtgagcctcactacccagcgactg
ccagttagcagaatcaagacctacaccatcacggaaggctccttgagagcagtaattttt
attaccaaacgtggcctaaaagtctgtgctgatccacaagccacgtgggtgagagacgtg
gtcaggagcatggacaggaaatccaacaccagaaataacatgatccagaccaagccaaca
ggaacccagcaatcgaccaatacagctgtgaccctgactggctag

DBGET integrated database retrieval system