KEGG   Homo sapiens (human): 685
Entry
685               CDS       T01001                                 
Symbol
BTC
Name
(RefSeq) betacellulin
  KO
K09783  betacellulin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    685 (BTC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    685 (BTC)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   685 (BTC)
SSDB
Motif
Pfam: EGF EphA2_TM Cadherin_C_2 Shisa Vpu LapA_dom TMEM154 Baculo_11_kDa Rhabdo_glycop TMEM52 Sema4F_C Sigma_reg_N CD34_antigen TMEM100 EAD9 DAG1 DUF6377 DUF2663
Other DBs
NCBI-GeneID: 685
NCBI-ProteinID: NP_001720
OMIM: 600345
HGNC: 1121
Ensembl: ENSG00000174808
Pharos: P35070(Tbio)
UniProt: P35070 A0A0S2Z437
Structure
LinkDB
Position
4:complement(74744759..74794523)
AA seq 178 aa
MDRAARCSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQS
KRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQIL
VICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA
NT seq 537 nt   +upstreamnt  +downstreamnt
atggaccgggccgcccggtgcagcggcgccagctccctgccactgctcctggcccttgcc
ctgggtctagtgatccttcactgtgtggtggcagatgggaattccaccagaagtcctgaa
actaatggcctcctctgtggagaccctgaggaaaactgtgcagctaccaccacacaatca
aagcggaaaggccacttctctaggtgccccaagcaatacaagcattactgcatcaaaggg
agatgccgcttcgtggtggccgagcagacgccctcctgtgtctgtgatgaaggctacatt
ggagcaaggtgtgagagagttgacttgttttacctaagaggagacagaggacagattctg
gtgatttgtttgatagcagttatggtagtttttattattttggtcatcggtgtctgcaca
tgctgtcaccctcttcggaaacgtcgtaaaagaaagaagaaagaagaagaaatggaaact
ctgggtaaagatataactcctatcaatgaagatattgaagagacaaatattgcttaa

DBGET integrated database retrieval system