KEGG   Homo sapiens (human): 6881
Entry
6881              CDS       T01001                                 

Gene name
TAF10, TAF2A, TAF2H, TAFII30
Definition
(RefSeq) TATA-box binding protein associated factor 10
  KO
K03134  transcription initiation factor TFIID subunit 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    6881 (TAF10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    6881 (TAF10)
   03036 Chromosome and associated proteins [BR:hsa03036]
    6881 (TAF10)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     6881 (TAF10)
   Coactivators
    SAGA/TFTC/STAGA complex
     6881 (TAF10)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    PCAF complex
     6881 (TAF10)
    STAGA complex
     6881 (TAF10)
    TFTC complex
     6881 (TAF10)
    SAGA complex
     6881 (TAF10)
    SLIK complex
     6881 (TAF10)
SSDB
Motif
Pfam: TFIID_30kDa Bromo_TP
Other DBs
NCBI-GeneID: 6881
NCBI-ProteinID: NP_006275
OMIM: 600475
HGNC: 11543
Ensembl: ENSG00000166337
Vega: OTTHUMG00000133402
Pharos: Q12962(Tbio)
UniProt: Q12962
LinkDB
Structure
PDB: 
4WV4 6MZC 6MZM 6MZD 6MZL

Position
11p15.4
AA seq 218 aa
MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGG
TGPLAARAGEPAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFL
MQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTA
SGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT
NT seq 657 nt   +upstreamnt  +downstreamnt
atgagctgcagcggctccggcgcggaccccgaggcggcgccggcctccgccgcctcggcc
ccgggccccgcgcccccggtctcggctcccgccgcgctgccctccagcaccgccgcggag
aacaaggccagccccgcggggacagcggggggacctggggctggagcagctgctgggggc
acgggacccttggcggcgcgggccggggagccagctgagcggcgtggggcggctccggtg
tcggcgggtggcgcggcgcccccggagggggccatatctaacggggtttacgtactgccg
agcgcggccaacggagacgtgaagcccgtggtgtccagcacgcctttggtggacttcttg
atgcagctggaagattacacgcctacgatcccagatgcagtgactggttactacctgaac
cgtgctggctttgaggcctcagacccacgcataattcggctcatctccttagctgcccag
aaattcatctcagatattgccaatgatgccctacagcactgcaaaatgaagggcacggcc
tccggcagctcccggagcaagagcaaggaccgcaagtacactctaaccatggaggacttg
acccctgccctcagcgagtatggcatcaatgtgaagaagccgcactacttcacctga

DBGET integrated database retrieval system