KEGG   Homo sapiens (human): 710
Entry
710               CDS       T01001                                 
Symbol
SERPING1, C1IN, C1INH, C1NH, HAE1, HAE2
Name
(RefSeq) serpin family G member 1
  KO
K04001  C1 inhibitor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05133  Pertussis
Network
nt06513  Complement cascade
nt06514  Coagulation cascade
  Element
N01520  Regulation of fibrinolytic system, C1INH
Disease
H00106  Complement regulatory protein defects
H01006  Hereditary angioedema
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    710 (SERPING1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    710 (SERPING1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    710 (SERPING1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    710 (SERPING1)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I4: serpin family
   710 (SERPING1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   710 (SERPING1)
SSDB
Motif
Pfam: Serpin PT
Other DBs
NCBI-GeneID: 710
NCBI-ProteinID: NP_000053
OMIM: 606860
HGNC: 1228
Ensembl: ENSG00000149131
Pharos: P05155(Tbio)
UniProt: P05155 E9KL26
Structure
LinkDB
Position
11:57597685..57614848
AA seq 500 aa
MASRLTLLTLLLLLLAGDRASSNPNATSSSSQDPESLQDRGEGKVATTVISKMLFVEPIL
EVSSLPTTNSTTNSATKITANTTDEPTTQPTTEPTTQPTIQPTQPTTQLPTDSPTQPTTG
SFCPGPVTLCSDLESHSTEAVLGDALVDFSLKLYHAFSAMKKVETNMAFSPFSIASLLTQ
VLLGAGENTKTNLESILSYPKDFTCVHQALKGFTTKGVTSVSQIFHSPDLAIRDTFVNAS
RTLYSSSPRVLSNNSDANLELINTWVAKNTNNKISRLLDSLPSDTRLVLLNAIYLSAKWK
TTFDPKKTRMEPFHFKNSVIKVPMMNSKKYPVAHFIDQTLKAKVGQLQLSHNLSLVILVP
QNLKHRLEDMEQALSPSVFKAIMEKLEMSKFQPTLLTLPRIKVTTSQDMLSIMEKLEFFD
FSYDLNLCGLTEDPDLQVSAMQHQTVLELTETGVEAAAASAISVARTLLVFEVQQPFLFV
LWDQQHKFPVFMGRVYDPRA
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggcctccaggctgaccctgctgaccctcctgctgctgctgctggctggggatagagcc
tcctcaaatccaaatgctaccagctccagctcccaggatccagagagtttgcaagacaga
ggcgaagggaaggtcgcaacaacagttatctccaagatgctattcgttgaacccatcctg
gaggtttccagcttgccgacaaccaactcaacaaccaattcagccaccaaaataacagct
aataccactgatgaacccaccacacaacccaccacagagcccaccacccaacccaccatc
caacccacccaaccaactacccagctcccaacagattctcctacccagcccactactggg
tccttctgcccaggacctgttactctctgctctgacttggagagtcattcaacagaggcc
gtgttgggggatgctttggtagatttctccctgaagctctaccacgccttctcagcaatg
aagaaggtggagaccaacatggccttttccccattcagcatcgccagcctccttacccag
gtcctgctcggggctggggagaacaccaaaacaaacctggagagcatcctctcttacccc
aaggacttcacctgtgtccaccaggccctgaagggcttcacgaccaaaggtgtcacctca
gtctctcagatcttccacagcccagacctggccataagggacacctttgtgaatgcctct
cggaccctgtacagcagcagccccagagtcctaagcaacaacagtgacgccaacttggag
ctcatcaacacctgggtggccaagaacaccaacaacaagatcagccggctgctagacagt
ctgccctccgatacccgccttgtcctcctcaatgctatctacctgagtgccaagtggaag
acaacatttgatcccaagaaaaccagaatggaaccctttcacttcaaaaactcagttata
aaagtgcccatgatgaatagcaagaagtaccctgtggcccatttcattgaccaaactttg
aaagccaaggtggggcagctgcagctctcccacaatctgagtttggtgatcctggtaccc
cagaacctgaaacatcgtcttgaagacatggaacaggctctcagcccttctgttttcaag
gccatcatggagaaactggagatgtccaagttccagcccactctcctaacactaccccgc
atcaaagtgacgaccagccaggatatgctctcaatcatggagaaattggaattcttcgat
ttttcttatgaccttaacctgtgtgggctgacagaggacccagatcttcaggtttctgcg
atgcagcaccagacagtgctggaactgacagagactggggtggaggcggctgcagcctcc
gccatctctgtggcccgcaccctgctggtctttgaagtgcagcagcccttcctcttcgtg
ctctgggaccagcagcacaagttccctgtcttcatggggcgagtatatgaccccagggcc
tga

DBGET integrated database retrieval system