KEGG   Homo sapiens (human): 7341
Entry
7341              CDS       T01001                                 
Symbol
SUMO1, DAP1, GMP1, OFC10, PIC1, SENP2, SMT3, SMT3C, SMT3H3, UBL1
Name
(RefSeq) small ubiquitin like modifier 1
  KO
K12160  small ubiquitin-related modifier
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa05418  Fluid shear stress and atherosclerosis
Disease
H00516  Cleft lip and/or cleft palate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    7341 (SUMO1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    7341 (SUMO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7341 (SUMO1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    7341 (SUMO1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7341 (SUMO1)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   7341 (SUMO1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    7341 (SUMO1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    7341 (SUMO1)
SSDB
Motif
Pfam: Rad60-SLD ubiquitin CBM_35_2
Other DBs
NCBI-GeneID: 7341
NCBI-ProteinID: NP_001005781
OMIM: 601912
HGNC: 12502
Ensembl: ENSG00000116030
UniProt: P63165
LinkDB
Position
2:complement(202206171..202238597)
AA seq 101 aa
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMN
SLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
NT seq 306 nt   +upstreamnt  +downstreamnt
atgtctgaccaggaggcaaaaccttcaactgaggacttgggggataagaaggaaggtgaa
tatattaaactcaaagtcattggacaggatagcagtgagattcacttcaaagtgaaaatg
acaacacatctcaagaaactcaaagaatcatactgtcaaagacagggtgttccaatgaat
tcactcaggtttctctttgagggtcagagaattgctgataatcatactccaaaagaactg
ggaatggaggaagaagatgtgattgaagtttatcaggaacaaacggggggtcattcaaca
gtttag

DBGET integrated database retrieval system