KEGG   Homo sapiens (human): 7547
Entry
7547              CDS       T01001                                 
Symbol
ZIC3, HTX, HTX1, VACTERLX, ZNF203
Name
(RefSeq) Zic family member 3
  KO
K18487  zinc finger protein ZIC 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Disease
H00632  Heterotaxy
H01195  VACTERL/VATER association
H02199  Congenital heart defects, multiple type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7547 (ZIC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7547 (ZIC3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    7547 (ZIC3)
SSDB
Motif
Pfam: zf_ZIC zf-C2H2 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_4 zf-met zf-C2H2_8 zf-C2H2_6 zf-RING_15 PE zf-H2C2_5
Other DBs
NCBI-GeneID: 7547
NCBI-ProteinID: NP_003404
OMIM: 300265
HGNC: 12874
Ensembl: ENSG00000156925
Vega: OTTHUMG00000022525
Pharos: O60481(Tbio)
UniProt: O60481
Structure
LinkDB
Position
X:137566127..137577691
AA seq 467 aa
MTMLLDGGPQFPGLGVGSFGAPRHHEMPNREPAGMGLNPFGDSTHAAAAAAAAAAFKLSP
AAAHDLSSGQSSAFTPQGSGYANALGHHHHHHHHHHHTSQVPSYGGAASAAFNSTREFLF
RQRSSGLSEAASGGGQHGLFAGSASSLHAPAGIPEPPSYLLFPGLHEQGAGHPSPTGHVD
NNQVHLGLRGELFGRADPYRPVASPRTDPYAAGAQFPNYSPMNMNMGVNVAAHHGPGAFF
RYMRQPIKQELSCKWIDEAQLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWE
ECPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKC
EFEGCDRRFANSSDRKKHMHVHTSDKPYICKVCDKSYTHPSSLRKHMKVHESQGSDSSPA
ASSGYESSTPPAIASANSKDTTKTPSAVQTSTSHNPGLPPNFNEWYV
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgacgatgctcctggacggaggcccgcagttccctgggctgggagtgggcagcttcggc
gcgccgcgccaccacgagatgcccaaccgtgagccggcaggcatggggctgaatcccttc
ggggactcaacccacgccgccgccgccgccgccgccgccgctgccttcaagctgagccct
gccgcggcgcacgatctatcttcaggccagagctcggctttcacgccgcagggttcgggc
tacgccaacgccctgggccaccatcaccaccaccatcaccatcatcaccacaccagccag
gtgcccagctacggtggcgctgcctctgccgccttcaactcaacgcgcgagtttctgttc
cgccagcgcagctccgggctcagtgaggcggcctcgggtggcgggcagcacgggctcttc
gccggctcggcgagcagcctgcatgctccagctggcatccccgagccccctagctacttg
ctgtttcccgggctgcatgagcagggcgctgggcacccgtcgcccacagggcacgtggac
aacaaccaggtccacctggggctgcgtggggagctgttcggccgtgctgacccataccgc
ccagtggccagcccgcgcacggacccctacgcggccggcgctcagtttcctaactacagc
cccatgaacatgaacatgggagtgaacgtggcggcccaccacgggcccggcgccttcttc
cgttatatgcggcagcctatcaagcaggagctgtcgtgcaagtggatcgacgaggctcag
ctgagccggcccaagaagagctgcgaccggaccttcagcaccatgcatgagctggtgaca
catgtcaccatggagcatgtggggggcccggagcagaacaaccacgtctgctactgggag
gagtgcccccgggagggcaagtctttcaaggcgaagtacaaactggtcaaccacatccga
gtgcacacgggcgagaagcccttcccatgccccttcccgggctgcgggaagatctttgcc
cgttctgagaacctcaagatccacaagaggacccacacaggtgagaaacctttcaaatgt
gaatttgaaggctgtgacagacgctttgccaacagcagcgaccgtaagaagcacatgcat
gtgcatacctcggacaagccctatatctgcaaagtgtgcgacaagtcctacacgcacccg
agctccctgcgcaaacacatgaaggttcatgaatctcaagggtcagattcctcccctgct
gccagttcaggctatgaatcttccactccacccgctatagcttctgcaaacagtaaagat
accactaaaaccccttctgcagttcaaactagcaccagccacaaccctggacttcctcct
aattttaacgaatggtacgtctga

DBGET integrated database retrieval system