KEGG   Homo sapiens (human): 7802
Entry
7802              CDS       T01001                                 

Gene name
DNALI1, P28, dJ423B22.5, hp28
Definition
(RefSeq) dynein axonemal light intermediate chain 1
  KO
K10410  dynein light intermediate chain, axonemal
Organism
hsa  Homo sapiens (human)
Pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    7802 (DNALI1)
   05016 Huntington disease
    7802 (DNALI1)
   05022 Pathways of neurodegeneration - multiple diseases
    7802 (DNALI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7802 (DNALI1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     7802 (DNALI1)
SSDB
Motif
Pfam: Ax_dynein_light RIB43A TSNAXIP1_N
Other DBs
NCBI-GeneID: 7802
NCBI-ProteinID: NP_003453
OMIM: 602135
HGNC: 14353
Ensembl: ENSG00000163879
Vega: OTTHUMG00000004222
Pharos: O14645(Tdark)
UniProt: O14645 A0A499FIY3
LinkDB
Position
1p34.3
AA seq 258 aa
MIPPADSLLKYDTPVLVSRNTEKRSPKARLLKVSPQQPGPSGSAPQPPKTKLPSTPCVPD
PTKQAEEILNAILPPREWVEDTQLWIQQVSSTPSTRMDVVHLQEQLDLKLQQRQARETGI
CPVRRELYSQCFDELIREVTINCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKAL
QAEQGKSDMERKIAELETEKRDLERQVNEQKAKCEATEKRESERRQVEEKKHNEEIQFLK
RTNQQLKAQLEGIIAPKK
NT seq 777 nt   +upstreamnt  +downstreamnt
atgattccgcccgcagactctttgctcaagtacgacaccccagtgctggtgagccggaac
acggagaaacggagccccaaggctcggctactgaaagtcagcccccagcagcctggacct
tcaggttcagccccacagccacccaagaccaagctcccctcaactccctgtgtcccagat
cctacaaagcaggcagaagaaatcttgaatgccatactacccccaagggagtgggtggaa
gacacgcagctatggatccagcaggtgtccagcacccctagcaccaggatggacgtggtg
cacctccaggagcagttagacttaaagctgcagcagcggcaggccagggaaacaggcatc
tgccctgtccgcagggaactctactcacagtgttttgatgagttgatccgggaggtcacc
atcaactgtgcggagagggggctgctgctgctgcgagtccgggacgagatccgcatgacc
atcgctgcctaccagaccctgtacgagagcagcgtggcgtttggcatgaggaaggcactg
caggctgagcaggggaagtcagacatggagaggaaaatcgcagaattggagacggaaaag
agagacctggagaggcaagtgaacgagcagaaggcaaaatgtgaagccactgagaagcgg
gagagcgagaggcggcaggtggaggagaagaagcacaatgaggagattcagttcctgaag
cgaacaaatcagcagctgaaggcccaactggaaggcattattgcaccaaagaagtga

DBGET integrated database retrieval system