KEGG   Homo sapiens (human): 79633
Entry
79633             CDS       T01001                                 

Gene name
FAT4, CDHF14, CDHR11, FAT-J, FATJ, HKLLS2, NBLA00548, VMLDS2
Definition
(RefSeq) FAT atypical cadherin 4
  KO
K16669  protocadherin Fat 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04392  Hippo signaling pathway - multiple species
Disease
H01393  Van Maldergem syndrome
H02169  Hennekam lymphangiectasia-lymphedema syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04392 Hippo signaling pathway - multiple species
    79633 (FAT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    79633 (FAT4)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Cadherin related
   79633 (FAT4)
SSDB
Motif
Pfam: Cadherin Cadherin_2 Laminin_G_2 Laminin_G_1 Cadherin_3 EGF EGF_CA hEGF EGF_3 Big_9 EGF_2 SusE
Other DBs
NCBI-GeneID: 79633
NCBI-ProteinID: NP_078858
OMIM: 612411
HGNC: 23109
Ensembl: ENSG00000196159
Vega: OTTHUMG00000133100
Pharos: Q6V0I7(Tbio)
UniProt: Q6V0I7 B3KU84
LinkDB
Position
4q28.1
AA seq 4981 aa
MDLAPDRATGRPWLPLHTLSVSQLLRVFWLLSLLPGQAWVHGAEPRQVFQVLEEQPPGTL
VGTIQTRPGFTYRLSESHALFAINSSTGALYTTSTIDRESLPSDVINLVVLSSAPTYPTE
VRVLVRDLNDNAPVFPDPSIVVTFKEDSSSGRQVILDTATDSDIGSNGVDHRSYRIIRGN
EAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTV
QDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQMDP
ETGLITVREPLDFEARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPA
TSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLI
KVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVY
RVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTGSSGGL
DRELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGT
ELLMLRATDGDLGDNGTVRFSLQEAETDRRSFRLDPVSGRLSTISSLDREEQAFYSLLVL
ATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGT
NGTVKYSISAGDRSRFQVNAQSGVISTRMALDREEKTAYQLQIVATDGGNLQSPNQAIVT
ITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSASTMDLNSNISYLITTGDQKGMFA
INQVTGQLTTANVIDREEQSFYQLKVVASGGTVTGDTMVNITVKDLNDNSPHFLQAIESV
NVVENWQAGHSIFQAKAVDPDEGVNGMVLYSLKQNPKNLFAINEKNGTISLLGPLDVHAG
SYQIEILASDMGVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQA
SDKDSGANGEIAYTIAEGNTGDAFGIFPDGQLYIKSELDRELQDRYVLMVVASDRAVEPL
SATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFE
MVQPDFELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYM
KDINDNAPKFLKDFYQATISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQFAI
DSTSGQVTLIGKLDYEATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTL
FVDVLENMRIGELVSSVTATDSDSGDNADLYYSITGTNNHGTFSISPNTGSIFLAKKLDF
ETQSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVENIPIGTSVI
SVTAHDPDADINGQLSYTIIQQMPRGNHFTIDEVKGTIYTNAEIDREFANLFELTVKAND
QAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAADPSAVIGSVLTTIMAADPDEGAN
GEIEYEIINGDTDTFIVDRYSGDLRVASALVPSQLIYNLIVSATDLGPERRKSTTELTII
LQGLDGPVFTQPKYITILKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRL
FTIGRHTGIIQTAAILDREQGACLYLVDVYAIEKSTAFPRTQRAEVEITLQDINDNPPVF
PTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTIISGADDSFRIDPESGDLIATR
RLDRERRSKYSLLVRADDGLQSSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLV
AAILATDDDSGVNGEITYIVNEDDEDGIFFLNPITGVFNLTRLLDYEVQQYYILTVRAED
GGGQFTTIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLT
YSIASGDSLGQFTVDKNGVLKVLKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSII
LLDVNDNPPTFLSPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPLGNKFSIG
TIDGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYK
VEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDRE
KTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVFELSPYSVNVPENLGTLPRTIL
QVVARDDDRGSNSKLSYVLFGGNEDNAFTLSASGELGVTQSLDRETKERFVLMITATDSG
SPALTGTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAVIR
IIGGNSQFTINPSTGQIITSALLDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVN
DNPPRFQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNSELHYSLSGRNSEKFHIDPLRG
AIMAAGPLNGASEVTFSVHVKDGGSFPKTDSTTVTVRFVNKADFPKVRAKEQTFMFPENQ
PVSSLVTTITGSSLRGEPMSYYIASGNLGNTFQIDQLTGQVSISQPLDFEKIQKYVVWIE
ARDGGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPRKILTVSAMDKDSGPN
GQLDYEIVNGNMENSFSINHATGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQSTSVKVM
INILDENDNAPRFSQIFSAHVPENSPLGYTVTRVTTSDEDIGINAISRYSIMDASLPFTI
NPSTGDIVISRPLNREDTDRYRIRVSAHDSGWTVSTDVTIFVTDINDNAPRFSRTSYYLD
CPELTEIGSKVTQVFATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQILKYQNVTG
FSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGT
KLIRVTAIDDKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVT
AKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAM
NGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSV
TVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSDL
FVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVS
KLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGI
LDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPIFTLNIYSVQISEGVPIG
THVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETLPIYNLSV
LAVDSGTPSATGSASLLVTLEDINDNGPMLTVSEGEVMENKRPGTLVMTLQSTDPDLPPN
QGPFTYYLLSTGPATSYFSLSTAGVLSTTREIDREQIADFYLSVVTKDSGVPQMSSTGTV
HITVIDQNDNPSQSRTVEIFVNYYGNLFPGGILGSVKPQDPDVLDSFHCSLTSGVTSLFS
IPGGTCDLNSQPRSTDGTFDLTVLSNDGVHSTVTSNIRVFFAGFSNATVDNSILLRLGVP
TVKDFLTNHYLHFLRIASSQLTGLGTAVQLYSAYEENNRTFLLAAVKRNHNQYVNPSGVA
TFFESIKEILLRQSGVKVESVDHDSCVHGPCQNGGSCLRRLAVSSVLKSRESLPVIIVAN
EPLQPFLCKCLPGYAGSWCEIDIDECLPSPCHSGGTCHNLVGGFSCSCPDGFTGRACERD
INECLQSPCKNGAICQNFPGSFNCVCKTGYTGKMCESSVNYCECNPCFNGGSCQSGVDSY
YCHCPFGVFGKHCELNSYGFEELSYMEFPSLDPNNNYIYVKFATIKSHALLLYNYDNQTG
DRAEFLALEIAEERLRFSYNLGSGTYKLTTMKKVSDGHFHTVIARRAGMAASLTVDSCSE
NQEPGYCTVSNVAVSDDWTLDVQPNRVTVGGIRSLEPILQRRGHVESHDFVGCIMEFAVN
GRPLEPSQALAAQGILDQCPRLEGACTRSPCQHGGTCMDYWSWQQCHCKEGLTGKYCEKS
VTPDTALSLEGKGRLDYHMSQNEKREYLLRQSLRGAMLEPFGVNSLEVKFRTRSENGVLI
HIQESSNYTTVKIKNGKVYFTSDAGIAGKVERNIPEVYVADGHWHTFLIGKNGTATVLSV
DRIYNRDIIHPTQDFGGLDVLTISLGGIPPNQAHRDAQTAGFDGCIASMWYGGESLPFSG
KHSLASISKTDPSVKIGCRGPNICASNPCWGDLLCINQWYAYRCVPPGDCASHPCQNGGS
CEPGLHSGFTCSCPDSHTGRTCEMVVACLGVLCPQGKVCKAGSPAGHVCVLSQGPEEISL
PLWAVPAIVGSCATVLALLVLSLILCNQCRGKKAKNPKEEKKPKEKKKKGSENVAFDDPD
NIPPYGDDMTVRKQPEGNPKPDIIERENPYLIYDETDIPHNSETIPSAPLASPEQEIEHY
DIDNASSIAPSDADIIQHYKQFRSHTPKFSIQRHSPLGFARQSPMPLGASSLTYQPSYGQ
GLRTSSLSHSACPTPNPLSRHSPAPFSKSSTFYRNSPARELHLPIRDGNTLEMHGDTCQP
GIFNYATRLGRRSKSPQAMASHGSRPGSRLKQPIGQIPLESSPPVGLSIEEVERLNTPRP
RNPSICSADHGRSSSEEDCRRPLSRTRNPADGIPAPESSSDSDSHESFTCSEMEYDREKP
MVYTSRMPKLSQVNESDADDEDNYGARLKPRRYHGRRAEGGPVGTQAAAPGTADNTLPMK
LGQQAGTFNWDNLLNWGPGFGHYVDVFKDLASLPEKAAANEEGKAGTTKPVPKDGEAEQY
V
NT seq 14946 nt   +upstreamnt  +downstreamnt
atggacttagcaccagacagggctactggccgcccgtggctcccgttgcacactctatca
gtatctcagctccttcgagtgttttggctactgtcattgcttccggggcaggcctgggtc
cacggggccgagccgcgccaggtgttccaagtgctggaagagcaacctccaggcactctg
gtaggcaccatccagacgcgccccggcttcacctacaggctcagcgaaagccacgccctg
tttgccataaacagtagcaccggagccctgtacaccacctccaccatcgaccgcgagagc
ctgcccagcgacgtgatcaacctggtggtcctttccagcgcgcccacctaccccaccgaa
gtgcgagtgctggtgcgggacctcaatgacaacgcccccgttttcccggacccctctatc
gtggtcactttcaaggaagacagtagcagcggacgccaagtcatcttagacaccgccacc
gactcggacatcggctcaaacggtgtggaccaccgctcctaccgcatcatccgcggcaat
gaggcggggcgcttccgtctggacatcaccctgaacccgagcggcgagggagcgttcctg
catctggtgtccaagggcggactggaccgtgaggtcactccgcagtaccagctcctggtt
gaggtggaggacaagggtgagcctaagcggcggggctaccttcaggtaaacgtgactgtg
caagacattaatgacaaccccccggtttttggcagttctcactaccaggcgggggtgcct
gaggacgcggttgtgggttccagcgtcctccaggtggcggcggcggacgcggacgagggc
accaacgcggacatccgctatcgcctgcaggacgaggggacccccttccaaatggaccct
gagacgggacttatcacggtgcgggagcccctggacttcgaagctcggcgccaatactcg
cttacggtgcaggcgatggacagaggcgtgccttccctcactgggcgcgccgaggcgctg
attcagctgctggacgtgaatgacaatgacccggtagtgaagttccgctacttcccggcc
acctcgcgctacgcctcggtagatgagaatgctcaagtgggcaccgtggtggctctgctc
accgtgacggacgcagattctcccgcggccaacgggaacatctccgtgcaaattctcggg
ggcaatgagcagcgccactttgaagtgcaaagcagcaaagtgccgaacctgagcctaatc
aaggtggccagcgccttggaccgcgagcgcatcccttcctacaacctcacagtttccgtc
tctgataactacggggcgccccctggcgcagcagtccaggcgcgctcttctgtggcaagc
ctggtgatttttgttaatgacatcaatgaccatcctcctgtcttttcacagcaagtgtac
agagtgaacctgagcgaggaggcgcctccgggaagctatgtgagtgggatatctgccact
gatggcgactctggtctcaatgctaatctgcgttacagcattgtctctggcaatggactg
ggatggttccatatcagtgaacatagcggcctcgtgaccactgggtcctctgggggcctg
gaccgtgaacttgcttcccagattgttctgaatataagtgcccgggaccagggagttcac
cccaaggtgtcctatgcccagcttgtagtaactctcctagatgtgaatgatgaaaagcca
gtatttagccagccagaagggtatgatgtgtctgtggttgagaatgccccaacagggaca
gaactgttgatgctcagggcaactgacggggacctgggtgacaacggaacagtgcgcttc
tccttacaagaggcagagactgaccggaggtccttccgtctggatcctgtgtctgggagg
ttgagtactatttcctccttggacagagaagagcaagccttctactccctgttggttctg
gccacagatctgggctcccctccccagtcatcaatggctcgcataaatgtgagtcttctg
gatataaatgataacagccctgtcttctacccggtccaatactttgctcacattaaggag
aatgagcctggaggtagctacatcaccactgtgtctgccactgacccagacttgggtacc
aatggtactgtcaaatatagcatatctgctggggacaggtctcggtttcaggtcaatgct
cagagtggggttatttctacaagaatggccctagacagagaagaaaaaacagcttatcag
ttgcaaatagtagctactgatggtggcaatttacaatctcccaaccaggcaatagtaacc
atcactgtattggacactcaagacaacccacctgtattcagtcaggttgcctacagcttt
gtggtttttgagaacgtggcgctgggatatcatgtgggtagtgtgtctgcatccaccatg
gatctcaattccaacatcagttatctcattactactggggatcagaaaggtatgtttgct
atcaaccaggtcactgggcagcttaccacagcaaatgtgattgatagagaagagcaatcc
ttttatcagctgaaggtagtggccagtgggggcacagtgactggagacactatggttaac
ataacagttaaggatttgaatgacaactctccccatttccttcaggcaatagagagtgta
aatgtggtggagaattggcaggcaggtcacagcattttccaggccaaagctgtggaccct
gatgaaggtgtcaatggcatggtactctatagtctgaagcaaaaccccaagaacctgttt
gctatcaatgaaaagaatggcactattagtctgcttgggcccctggatgttcatgctggc
tcctaccaaatagagatcttggcatctgacatgggtgtcccacagctctcctctagtgtc
atcttaacagtttatgtccatgatgtaaatgacaattcaccagtgtttgaccaactctct
tatgaagtcaccctttctgagtcagaacctgtgaattctcgattctttaaagtacaagct
tctgataaggattcaggagcaaatggtgaaattgcatacaccattgctgaaggaaataca
ggggatgcttttggcatattcccagatggtcaattgtatataaaaagtgaactggaccgt
gaacttcaagacagatatgttttaatggttgttgcttctgacagagcagtggaacccctt
agtgctactgtgaatgttactgtaattttagaagatgtaaatgataacagacctcttttt
aacagtaccaattacacattttacttcgaagaagagcagagggctgggtcgtttgtgggc
aaagtaagtgctgtagataaagactttgggccaaatggagaagtaaggtattcttttgaa
atggtgcagccagattttgagttgcatgccatcagtggggaaattacaaatactcatcag
tttgacagggagtctcttatgaggcggagagggactgctgtgtttagctttacagtcata
gcaacagatcaggggatccctcagcctctcaaggatcaggccactgtacatgtttacatg
aaggatataaatgataatgctcccaaatttttaaaagacttttaccaagctacaatatca
gaatcagcagccaatctgacacaagtgttaagagtatctgcctcagatgttgatgaaggt
aataatggacttattcactattctataataaaaggaaatgaagaaagacagtttgctata
gacagtacctctggtcaggtaacactaattggcaaattagactatgaagcaacacctgcc
tattcccttgtaattcaagcagtggattcagggacaatccccctcaattcaacgtgtact
ttaaatattgatattttagatgaaaatgacaataccccttctttccctaaatcaacactc
tttgttgatgttttggaaaacatgagaattggtgaactcgtgtcctctgttactgcaact
gattccgattcaggtgacaatgctgatttatattacagtattactgggactaacaaccac
ggaacttttagcattagcccaaacactgggagtatttttcttgccaaaaaactggacttt
gaaacacagtctttgtataaattaaatataacagcaaaagaccaaggaagacctcctcgt
tcatctacaatgtcagtggttattcacgtgagggactttaatgacaatcctcctagcttt
cctcctggagatattttcaagtctattgttgagaacattcccatcggtacatctgtcatt
tcagtgactgcacatgaccctgatgcagacattaatggtcaactatcctacacaatcatt
caacagatgccaagaggcaaccactttaccatagatgaagtcaaagggactatatatact
aatgctgaaatagatcgggaatttgctaatctctttgagttgactgtaaaagccaatgat
caagctgtgccaatagaaactagacggtatgctttgaagaacgtgaccattttggttaca
gacctcaatgacaatgtcccaatgtttatatcacaaaacgcccttgctgcagacccatca
gctgtgattggttccgttctgacaacaattatggctgctgacccagatgaaggtgctaat
ggagaaatagagtatgagatcatcaatggggacacagacaccttcattgttgatcgttat
agtggagacctgagagtggcttcagcgttggtgccttcacagttgatctacaatctcata
gtttcagcaacagaccttgggcctgaaaggaggaaatcgaccactgaattgaccatcatt
cttcagggccttgatggacctgtttttactcaacccaaatatataactattttgaaggaa
ggagaacccattggcacaaacgtgatatcaatagaagcagctagccccagaggatctgag
gccccagtggagtattatattgtttcagttcgttgtgaagaaaaaactgttggacgcctc
tttactattggacgacatactggtataattcagaccgcagccattctggaccgggagcaa
ggagcatgtctttacctggtggatgtttatgccatagaaaaatcaactgcttttcccaga
acacagagagcagaggtagaaataacacttcaggatatcaatgacaatccaccagtattt
ccaacggacatgctggatctcacggtagaggagaacattggagatggctctaagattatg
cagctgacagccatggatgctgatgagggtgcaaatgctctcgtcacatacactatcatt
agtggagctgatgatagttttcgcatcgacccagaatccggagatctgatagcaaccagg
cggttggacagggaacgccgctccaaatattcactgctagttcgtgctgatgatggtctt
cagtcctcggatatgagaattaatatcactgtcagtgatgtgaatgaccatacacccaaa
ttttccagacccgtgtactcttttgacattcctgaggacacaatccctggttctttggta
gcagccattttagccacggatgatgactctggtgtgaatggagaaattacatatattgtg
aatgaagatgatgaagatggcatctttttcctgaatcctattactggggtctttaatttg
actcgattattagattatgaagtacagcaatattatatcctcactgttcgagcagaagat
ggtgggggacaatttactaccatcagagtttatttcaatattctagatgtaaatgataat
ccacctattttcagcttgaattcatacagcacatctttaatggagaatctacctgtggga
tctactgttcttgtgtttaatgttactgatgcagatgatggcatcaactctcaattgact
tatagcattgcttcaggtgatagccttgggcagtttactgttgacaagaatggtgtactc
aaagtcctaaaagctttggatcgggaaagtcagtccttctacaacttggttgttcaagtg
catgacctgccacagattccagcctccagattcacaagcactgctcaagtctccattatt
ttgttggatgtaaatgataacccaccgacatttctttcccctaaattgacatacattcca
gaaaatacacctattgatactgttgttttcaaagctcaagcaactgacccagatagtggc
ccaaacagctatattgagtacactctgctgaaccctttgggaaacaagttcagtattggg
accattgatggtgaagtgaggctcactggagaactggacagagaagaagtttctaattat
actctaacagtggtggctacagacaaaggtcaaccatctctctcttcatctacagaggtt
gtagttatggtacttgacatcaatgataacaaccccatctttgcacaagctttgtataaa
gtggagattaatgaaaacacacttactggaacagatataatacaagtgttcgcagcagat
ggagatgaaggcacaaatggacaggttcgctatggcattgttaatggtaataccaatcag
gaatttcggatagactctgtcacaggtgccatcactgtcgctaaacctttggatagagaa
aagacccctacctaccatttaactgttcaggcaacagatcgaggcagcacacccagaact
gatacctccacggtcagcattgttctactggatattaatgactttgttcctgtatttgag
ctatctccatattctgtaaatgtccctgagaatttagggacactacccagaacaattctt
caggtggtggcaagagatgatgatcgaggatctaacagcaaactctcatatgttctgttt
ggtggtaatgaagacaatgcttttactctctcagccagtggagaacttggagtaacacag
agtctggatcgggaaacaaaagagcgctttgtcttaatgattacagctacagattcagga
tcccctgccttgactggaactggaacaatcaacgtcatagtagatgatgtcaatgacaat
gtccccacatttgccagtaaagcgtatttcacaacaattcctgaggatgcaccaactgga
acagatgttttattggtaaatgcctcagatgctgatgcttcaaagaatgcagttataagg
atcatcggtggaaactctcagttcacgatcaacccatcgacaggacaaatcatcaccagc
gcattgttagatagggaaacaaaagataattatactttggtagtggtctgcagtgatgcg
ggatccccagagcctctttccagttccaccagtgtgcttgtcactgtgactgatgtcaat
gacaatccaccaagatttcagcatcacccatatgtcactcacatcccatctcctactctt
ccaggttcctttgtctttgcggttacagtcacagatgctgatattggaccaaattctgaa
ctgcattattctctttcgggtagaaattctgaaaaatttcacattgacccactgagggga
gccattatggccgccggaccactaaacggagcttcagaagtgacattttctgtgcatgta
aaagatggtggctcatttccaaagacagattctacaacagtgactgttagattcgtgaat
aaggccgatttccctaaagtgagagccaaagaacaaacgttcatgtttcctgaaaaccaa
ccagtcagctctcttgtcaccaccatcacaggatcctctttaagaggagaacctatgtca
tattatatcgcaagtgggaatcttggcaatactttccagattgatcagttaacagggcag
gtgtctattagtcaacctctggattttgaaaagatacaaaaatatgttgtatggatagag
gccagagacggtggtttccctcctttctcctcttacgagaaacttgatataacagtatta
gatgtcaatgataatgccccaatttttaaggaagacccatttatatctgaaatattggaa
aacctttcccctcgaaaaatacttactgtttcggcaatggacaaggacagtggacccaat
ggacagttagattatgaaattgttaatggcaacatggaaaatagtttcagtatcaatcat
gctactggtgaaattagaagcgttagacctttggacagggaaaaagtatctcattatgtc
ctaaccataaaatcatcagacaaagggtccccgtctcagagtacttcagtaaaagtcatg
attaacattttagatgaaaatgataatgcccctaggttttctcagatatttagtgcccat
gttcctgaaaattcccccttaggatacacagttacccgtgtcacaacttctgatgaagac
attgggatcaatgcaattagtagatattctataatggatgcaagtcttccatttacaatt
aatcccagcacaggggatattgtcataagcagacctttaaatagggaagatacagaccgt
tacagaattcgagtttccgcacatgattctgggtggactgtaagtacagatgtcacaata
tttgtgacagacatcaatgacaatgctccaagatttagcagaacttcctattatttagat
tgccctgaacttactgagattggctccaaagtaactcaggtatttgcaacagatcctgat
gagggatcaaatggacaagtgttttatttcataaaatcccaatcagaatatttcaggatt
aatgccaccactggagagattttcaataaacagatcttaaaataccaaaatgtcactggc
ttcagtaatgtgaatatcaacaggcatagttttatagtgacatcttcagatcgaggtaaa
ccttccttaattagtgagacaacagttaccatcaatatagtggacagtaatgacaatgca
cctcaatttcttaaaagtaaatatttcactccagtcaccaaaaatgttaaggttggtacg
aagttaatcagagttacagcaatagatgacaaagattttggactgaattcagaagtggag
tatttcatttctaatgataaccatttaggaaaatttaagttggacaatgatacggggtgg
atttcagtagcatcctccctgatttctgacttgaaccaaaacttttttatcacagtcact
gcaaaggataagggaaaccctccactttcttcccaagcaactgttcacataactgtcact
gaggaaaactaccatacacctgaattctctcaaagccacatgagtgcaaccatccctgag
agccatagcattgggtccattgtcagaactgtttctgcaagagatagagatgcagcgatg
aatggcttgattaagtacagcatttcttcaggaaatgaagaaggcatttttgcaatcaat
tcttctacaggtatattaacactagccaaagctcttgattatgagctatgccagaaacac
gaaatgacgattagtgctatagatggaggatgggttgcaagaactggttactgcagtgtg
accgtaaatgtgattgatgtgaatgataattctccagtattcctctctgatgactatttc
cctactgttttggaaaatgccccaagtggaacaacagttatccacctaaatgcaacagat
gctgactctggaacaaatgctgtgattgcgtatactgtacagtcatctgacagtgacctc
tttgtcattgaccctaacacaggagtcataaccactcaaggcttcttggattttgaaacc
aagcagagctaccatcttactgtgaaagccttcaatgtccccgatgaggaaaggtgtagc
tttgccactgttaatatacaattaaaagggacaaatgaatatgtgccccgttttgtttcc
aaactttactattttgaaatctcagaagcagctcctaaaggtactattgttggagaagtg
tttgctagcgaccgtgatttgggcactgatggggaggtacactatttgatttttggtaat
agtcgaaagaagggtttccagatcaataagaagactggacagatttatgtttctggaatt
cttgatcgagaaaaagaagaaagggtgtctttgaaggtattggccaagaactttggcagc
attagaggtgcagatatagatgaggtcactgtaaatgtcaccgtgcttgatgcaaatgac
ccacccatttttactctaaacatctacagtgtgcagatcagtgaaggggtcccaatagga
actcatgtgacctttgtcagtgcctttgactcagactccatccccagctggagcaggttt
tcttacttcatcggatcagggaatgaaaatggtgccttttctattaatccgcagacagga
cagatcaccgttactgcagaattagatcgagaaacccttcccatctataatctctcagtt
ttggctgttgattcagggaccccctcagctacaggtagtgcctctttattagtcaccctg
gaagatataaatgataacgggcccatgctgactgtcagtgaaggagaagtcatggaaaac
aaacggccaggcactttggtgatgacccttcagtccactgaccctgatctccctccaaat
caaggtccctttacttattacttgctgagcacaggtcctgccaccagttatttcagtctg
agcactgctggagttctgagcacaaccagagagattgacagagagcagattgcagacttc
tatctgtctgtggttaccaaggattctggtgttcctcaaatgtcttccacaggaactgtg
catatcacagttatagaccaaaatgacaatccttcacagtctcggacggtggagatattt
gttaattattatggtaacttgtttcccggtgggattttaggctctgtgaagccacaggat
ccagatgtgttagacagcttccactgctcccttacttcaggagttaccagcctcttcagt
attccagggggtacttgtgatctgaattcccagccaaggtccacagatggcacgtttgat
ctgactgtccttagcaatgatggagttcacagcacagtcacgagcaacatccgagttttc
tttgctggattttccaatgccacagtggataacagcatcttacttcgtctcggcgtacca
acagtaaaggacttcttgaccaaccactatcttcattttttacgcattgccagctcacag
ctgacaggcttagggactgctgtgcaactgtacagtgcatatgaagagaacaatagaacg
tttcttttggcagctgtgaagcgaaatcataatcagtatgtgaatcccagtggcgtagcc
accttctttgaaagcatcaaagagatccttctccggcagagtggagtaaaggtggaatct
gtggatcatgactcctgtgtgcatggcccatgtcagaatggagggagctgtctacgaaga
ttggctgtgagctccgtattaaaaagccgtgagagtcttccagtcatcatcgtggcaaat
gaacctctgcagcctttcttatgcaagtgtctgccaggatatgcgggtagctggtgtgaa
atagatatagatgaatgtcttccatcaccttgccacagtggtggaacctgtcacaattta
gtgggaggattttcatgcagctgcccagatggcttcactggtagggcgtgtgagagagat
atcaatgagtgcctgcagagtccttgcaagaatggtgccatctgccagaattttccagga
agcttcaactgtgtttgcaaaactggatacacagggaaaatgtgtgaatcttcagtcaat
tactgtgaatgcaacccctgctttaatggtggttcctgccaaagtggtgtggattcttat
tattgtcattgtccatttggtgtctttggaaaacactgcgagttgaacagttatggattt
gaggagttatcatacatggaatttccaagcttggaccccaataacaactatatttatgtc
aaatttgccacgattaaaagtcatgccttattgctttacaactatgacaaccagacaggc
gaccgggctgagtttttggcccttgaaattgccgaagaaagactaagattctcttataat
ttaggcagtggtacatataagctcaccaccatgaagaaggtgtcagatggacattttcac
actgtgattgccaggagagcaggaatggcagcctccttaactgtggactcctgttctgag
aaccaagagccaggatattgtactgtcagtaatgtggcagtttcagatgactggactctt
gatgttcagccaaatagagttacagttggaggtatcagatctctagaaccaatccttcag
agaagaggacacgtggaaagccatgattttgttgggtgtataatggagtttgcagtcaat
ggaaggcctctggaacccagccaagctttggcagcacaaggcatcctagatcaatgccct
aggctggaaggcgcttgtactcgcagcccatgccaacatggtggcacatgtatggattac
tggtcatggcagcagtgtcattgcaaagagggactcactgggaaatactgtgaaaaatct
gttactcctgacactgccttatcattagaaggcaaagggcgcttggactaccacatgagt
cagaatgagaagcgggaatatttgttaaggcaaagcttacgaggtgccatgttggagcct
tttggtgtgaacagtctggaagtaaaatttaggaccagaagcgagaatggcgttttaatc
catatccaagaaagcagcaattacactactgtgaagattaagaatggcaaagtatatttt
acatccgatgcaggaattgctgggaaagtggagagaaatattcctgaagtatatgttgca
gacggccactggcacacttttctaattgggaaaaatggaacagcaacagtattgtctgtt
gacagaatatataacagagatattatccaccctactcaggacttcggtggccttgatgtg
cttactatatcacttggaggaattccacccaatcaagcacatcgagatgcccaaacagca
ggttttgatggctgcattgcttctatgtggtatggtggagaaagtcttcctttcagcggg
aagcatagcttggcctccatctcaaaaacagatccctcagtgaagattggctgccgtggc
ccgaacatttgtgccagcaacccctgctggggtgatttgctgtgcattaatcagtggtat
gcctacaggtgtgtccctcctggggactgtgcctcccacccgtgccagaatggtggcagc
tgtgagccaggcctgcactccggcttcacctgtagctgcccagactcgcacacgggaagg
acctgtgagatggtggtggcctgtcttggcgtcctctgtcctcaggggaaggtgtgcaaa
gctggaagtcctgcggggcatgtctgtgttctgagtcagggccctgaagagatctctctg
cctttgtgggctgtgcctgccatcgtgggcagctgcgcaaccgtcttggccctcctggtc
cttagcctgatcctgtgtaaccagtgcagggggaagaaggccaaaaatcccaaagaggag
aagaaaccgaaggagaagaagaaaaagggaagtgagaacgttgcttttgatgaccctgac
aatatccctccctatggggatgacatgactgtgaggaagcagcctgaagggaacccaaaa
ccagatatcattgaaagggaaaacccctaccttatctatgatgaaactgatattcctcac
aactcagaaaccatccccagcgcccctttggcatctccagagcaggagatagagcactat
gacattgacaacgccagcagcatcgccccttcggatgcagacatcattcaacactacaag
cagttccgcagccacacaccaaaattttcaatccagaggcacagtcccctaggctttgca
aggcaatcccccatgcccttaggagcaagcagtttgacttaccagccttcatatggtcaa
ggtttgagaaccagctccctaagccactcagcatgcccaactcccaaccctctgtctcga
cacagtccagcccctttctccaaatcttctacgttctatagaaacagcccagcaagggaa
ttgcatcttcctataagggatggtaatactttggaaatgcatggtgacacctgccaacct
ggcattttcaactatgccacaaggctgggaaggagaagcaagagtcctcaggccatggca
tcacatggttctagaccagggagtcgcctaaagcagccgattgggcagattccactggaa
tcttctcctccagtcggactttctattgaagaagtggagaggctcaacacacctcgccct
agaaacccaagtatctgcagtgcagaccatgggaggtcttcttcagaggaggactgcaga
aggccactgtctagaacaaggaatccagcggatggcattccagctccagaatcctcttct
gatagtgactcccatgaatctttcacttgctcagaaatggaatatgacagggagaagcca
atggtatatacttccagaatgcccaaattatctcaagtcaatgaatctgatgcagatgat
gaagataattatggagccagactgaagcctcgaaggtaccacggtcgcagggccgaggga
ggacctgtgggcacccaggcagcagcaccaggcactgctgacaacacactgcccatgaag
ctagggcagcaagcagggactttcaactgggacaaccttttgaactggggccctggcttt
ggccattatgtagatgtttttaaagatttggcatctcttccagaaaaagcagcagcaaat
gaagaaggcaaagctgggacaactaaaccagtccccaaagatggggaagcagaacagtat
gtgtga

DBGET integrated database retrieval system