KEGG   Homo sapiens (human): 8082
Entry
8082              CDS       T01001                                 
Symbol
SSPN, DAGA5, KRAG, NSPN, SPN1, SPN2
Name
(RefSeq) sarcospan
  KO
K22194  sarcospan
Organism
hsa  Homo sapiens (human)
Pathway
hsa04820  Cytoskeleton in muscle cells
hsa05410  Hypertrophic cardiomyopathy
hsa05412  Arrhythmogenic right ventricular cardiomyopathy
hsa05414  Dilated cardiomyopathy
hsa05416  Viral myocarditis
Network
nt06539  Cytoskeleton in muscle cells
  Element
N01816  Costamere
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04820 Cytoskeleton in muscle cells
    8082 (SSPN)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    8082 (SSPN)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    8082 (SSPN)
   05414 Dilated cardiomyopathy
    8082 (SSPN)
   05416 Viral myocarditis
    8082 (SSPN)
SSDB
Motif
Pfam: CD20
Other DBs
NCBI-GeneID: 8082
NCBI-ProteinID: NP_005077
OMIM: 601599
HGNC: 11322
Ensembl: ENSG00000123096
UniProt: Q14714
LinkDB
Position
12:26121991..26234777
AA seq 243 aa
MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQ
LALGIAVTVVGFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFS
MKLLYFLLSALGLTVCVLAVAFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRD
VTDCTSVTGTFKLFLLIQMILNLVCGLVCLLACFVMWKHRYQVFYVGVRICSLTASEGPQ
QKI
NT seq 732 nt   +upstreamnt  +downstreamnt
atgggcaagaacaagcagccacgcggccagcagaggcaggggggcccgccggccgcggac
gccgctgggcccgacgacatggagccgaagaagggcacgggggcccccaaggagtgcggg
gaggaggagccccggacctgctgcggctgccggttcccgctgctgctcgccctgctgcag
ctggccctgggcatcgccgtgaccgtggtgggcttcctcatggcgagcatcagctcctcc
ctgctagtcagggacactccattttgggctgggatcattgtctgcttagtggcctatctt
ggcttgtttatgctttgtgtctcatatcaggttgacgaacggacatgtattcaattttct
atgaaactgttatactttctgctgagtgccctgggcctgacggtctgtgtgctggccgtg
gcctttgccgcccaccactattcgcagctcacacagtttacctgtgagaccacactcgac
tcttgccagtgcaaactgccctcctcggagccgctcagcaggacctttgtttaccgggat
gtgacggactgtaccagcgtcactggcactttcaaactgttcttactcatccagatgatt
cttaatttggtctgcggccttgtgtgcttgttggcctgctttgtgatgtggaaacatagg
taccaggtcttctatgtgggtgtcaggatatgctccctcacggcttccgaaggcccccag
caaaagatctaa

DBGET integrated database retrieval system