KEGG   Homo sapiens (human): 8091
Entry
8091              CDS       T01001                                 
Symbol
HMGA2, BABL, HMGI-C, HMGIC, LIPO, SRS5, STQTL9
Name
(RefSeq) high mobility group AT-hook 2
  KO
K09283  high mobility group AT-hook protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
hsa05206  MicroRNAs in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Disease
H00711  Russell-Silver syndrome
H01640  Uterine leiomyoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8091 (HMGA2)
   05206 MicroRNAs in cancer
    8091 (HMGA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    8091 (HMGA2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    8091 (HMGA2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Other transcription factors
   HMGI(Y)
    8091 (HMGA2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    8091 (HMGA2)
SSDB
Motif
Pfam: AT_hook DUF5681
Other DBs
NCBI-GeneID: 8091
NCBI-ProteinID: NP_003474
OMIM: 600698
HGNC: 5009
Ensembl: ENSG00000149948
Vega: OTTHUMG00000168936
Pharos: P52926(Tbio)
UniProt: P52926
LinkDB
Position
12:65824460..65966291
AA seq 109 aa
MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSP
SKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED
NT seq 330 nt   +upstreamnt  +downstreamnt
atgagcgcacgcggtgagggcgcggggcagccgtccacttcagcccagggacaacctgcc
gccccagcgcctcagaagagaggacgcggccgccccaggaagcagcagcaagaaccaacc
ggtgagccctctcctaagagacccaggggaagacccaaaggcagcaaaaacaagagtccc
tctaaagcagctcaaaagaaagcagaagccactggagaaaaacggccaagaggcagacct
aggaaatggccacaacaagttgttcagaagaagcctgctcaggaggaaactgaagagaca
tcctcacaagagtctgccgaagaggactag

DBGET integrated database retrieval system