Homo sapiens (human): 81605 Help Entry 81605             CDS       T01001                                  Symbol URM1, C9orf74 Name (RefSeq) ubiquitin related modifier 1   KO K12161   ubiquitin related modifier 1 Organism hsa  Homo sapiens (human) Pathway hsa04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:hsa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     81605 (URM1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:hsa03016]     81605 (URM1)    04121 Ubiquitin system [BR:hsa04121]     81605 (URM1) Transfer RNA biogenesis [BR:hsa03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     81605 (URM1) Ubiquitin system [BR:hsa04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    81605 (URM1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Urm1 ThiS Motif Other DBs NCBI-GeneID:  81605 NCBI-ProteinID:  NP_112176 OMIM:  612693 HGNC:  28378 Ensembl:  ENSG00000167118 UniProt:  Q9BTM9 LinkDB All DBs Position 9:128371319..128392016 Genome browser AA seq 101 aa AA seqDB search MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQG DSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggctgcgcccttgtcagtggaggtggagttcggaggtggtgcggagctcctgtttgac ggtattaagaaacatcgagtcactttgcctggacaggaggaaccctgggacatccggaac ctgctcatctggatcaagaagaatttgctaaaagagcggccagagttgttcatccaggga gacagcgtgcggccaggaattctggtgctgattaacgatgccgactgggagctactgggt gagctggactaccagcttcaggaccaggacagcgtcctcttcatctccactctgcacggc ggctga

DBGET integrated database retrieval system