KEGG   Homo sapiens (human): 8315
Entry
8315              CDS       T01001                                 
Symbol
BRAP, BRAP2, IMP, RNF52
Name
(RefSeq) BRCA1 associated protein
  KO
K10632  BRCA1-associated protein [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    8315 (BRAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8315 (BRAP)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     8315 (BRAP)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    8315 (BRAP)
SSDB
Motif
Pfam: BRAP2 zf-UBP zf-RING_2 zf-C3HC4_2 zf-RING_5 zf-rbx1 zf-RING_UBOX zf-RING_11 zf-C3HC4 zf-ANAPC11 RRM_1 zf-C3HC4_3 zf-C3H2C3 GBP_C V_ATPase_I zf-RING_16 KASH_CCD DUF4407 Peptidase_S46 Baculo_PEP_C
Other DBs
NCBI-GeneID: 8315
NCBI-ProteinID: NP_006759
OMIM: 604986
HGNC: 1099
Ensembl: ENSG00000089234
Pharos: Q7Z569(Tbio)
UniProt: Q7Z569 Q59H81
LinkDB
Position
12:complement(111642146..111685956)
AA seq 592 aa
MSVSLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAII
HQHLGRREMTDVIIETMKSNPDELKTTVEERKSSEASPTAQRSKDHSKECINAAPDSPSK
QLPDQISFFSGNPSVEIVHGIMHLYKTNKMTSLKEDVRRSAMLCILTVPAAMTSHDLMKF
VAPFNEVIEQMKIIRDSTPNQYMVLIKFRAQADADSFYMTCNGRQFNSIEDDVCQLVYVE
RAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTC
PVCRYCQTPEPVEENKCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQL
TNHRVWDYAGDNYVHRLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQR
IYWENKIVRIEKDTAEEINNMKTKFKETIEKCDNLEHKLNDLLKEKQSVERKCTQLNTKV
AKLTNELKEEQEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQITEIQEQLRDVMFYL
ETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRSKRGK
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgagtgtgtcactggttgttatccgattggagctcgcggaacactcgcctgtccccgcc
ggcttcggcttcagcgccgcggccggggaaatgtctgatgaggagataaaaaagacgaca
ctagcctcagctgtagcctgtttagaaggcaagtcaccaggagagaaagtagcgattatc
catcagcatctcggccgtcgagaaatgacagatgtgatcattgagaccatgaagtccaac
ccagatgaactaaaaactacagtggaagaaaggaagtcttcagaagcctcccccactgcg
caaagaagtaaagatcacagtaaggaatgcataaacgctgccccagattctccgtccaaa
cagcttccagaccagatttcattcttcagtggaaatccatcagttgaaatagttcatggt
attatgcacctatataagacaaataagatgacctccttaaaagaagatgtgcggcgcagt
gccatgctgtgtattctcacagtccctgctgcaatgaccagtcatgaccttatgaagttt
gttgccccatttaacgaagtaattgaacaaatgaaaattatcagagactctactcccaac
caatatatggtgctgataaagtttcgtgcacaggctgatgcggatagtttttatatgaca
tgcaatggccgccagttcaactcaatagaagatgacgtttgccagctagtgtatgtggaa
agagctgaagtgctcaaatctgaagatggcgccagcctcccagtgatggacctgactgaa
ctccccaagtgcacggtgtgtctggagcgcatggacgagtctgtgaatggcatcctcaca
acgttatgtaaccacagcttccacagccagtgtctacagcgctgggacgataccacgtgt
cctgtttgccggtactgtcaaacgcccgagccagtagaagaaaataagtgttttgagtgt
ggtgttcaggaaaatctttggatttgtttaatatgcggccacataggatgtggacggtat
gtcagtcgacatgcttataagcactttgaggaaacgcagcacacgtatgccatgcagctt
accaaccatcgagtctgggactatgctggagataactatgttcatcgactggttgcaagt
aaaacagatggaaaaatagtacagtatgaatgtgagggggatacttgccaggaagagaaa
atagatgccttacagttagagtattcatatttactaacaagccagctggaatctcagcga
atctactgggaaaacaagatagttcggatagagaaggacacagcagaggaaattaacaac
atgaagaccaagtttaaagaaacaattgagaagtgtgataatctagagcacaaactaaat
gatctcctaaaagaaaagcagtctgtggaaagaaagtgcactcagctaaacacaaaagtg
gccaaactcaccaacgagctcaaagaggagcaggaaatgaacaagtgtttgcgagccaac
caagtcctcctgcagaacaagctaaaagaggaggagagggtgctgaaggagacctgtgac
caaaaagatctgcagatcaccgagatccaggagcagctgcgtgacgtcatgttctacctg
gagacacagcagaagatcaaccatctgcctgccgagacccggcaggaaatccaggaggga
cagatcaacatcgccatggcctcggcctcgagccctgcctcttcggggggcagtgggaag
ttgccctccaggaagggccgcagcaagaggggcaagtga

DBGET integrated database retrieval system