KEGG   Homo sapiens (human): 83937
Entry
83937             CDS       T01001                                 
Symbol
RASSF4, AD037
Name
(RefSeq) Ras association domain family member 4
  KO
K09851  Ras association domain-containing protein 2/4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04392 Hippo signaling pathway - multiple species
    83937 (RASSF4)
SSDB
Motif
Pfam: RA Nore1-SARAH DUF6565
Other DBs
NCBI-GeneID: 83937
NCBI-ProteinID: NP_114412
OMIM: 610559
HGNC: 20793
Ensembl: ENSG00000107551
Vega: OTTHUMG00000018060
Pharos: Q9H2L5(Tbio)
UniProt: Q9H2L5
LinkDB
Position
10:44959802..44995891
AA seq 321 aa
MKEDCLPSSHVPISDSKSIQKSELLGLLKTYNCYHEGKSFQLRHREEEGTLIIEGLLNIA
WGLRRPIRLQMQDDREQVHLPSTSWMPRRPSCPLKEPSPQNGNITAQGPSIQPVHKAESS
TDSSGPLEEAEEAPQLMRTKSDASCMSQRRPKCRAPGEAQRIRRHRFSINGHFYNHKTSV
FTPAYGSVTNVRVNSTMTTLQVLTLLLNKFRVEDGPSEFALYIVHESGERTKLKDCEYPL
ISRILHGPCEKIARIFLMEADLGVEVPHEVAQYIKFEMPVLDSFVEKLKEEEEREIIKLT
MKFQALRLTMLQRLEQLVEAK
NT seq 966 nt   +upstreamnt  +downstreamnt
atgaaggaagactgtctgccgagttctcacgtgcccatcagtgacagcaagtccattcag
aagtcggagctcttaggcctgctgaaaacctacaactgctaccatgagggcaagagcttc
cagctgagacaccgtgaggaagaagggactctgatcatcgaggggctcctcaacattgcc
tgggggctgaggcggcccatccggctgcagatgcaggatgaccgggagcaggtgcacctc
ccctccacctcatggatgcccagacggcctagctgccctctaaaggagccatcgccccag
aacgggaacatcacagcccaggggccaagcattcagccagtgcacaaggctgagagttcc
acagacagctcggggcccctggaggaggcagaggaggccccccagctgatgcggaccaag
agcgacgccagttgcatgagccagaggaggcccaagtgccgcgcccccggtgaggcccag
cgcatccggcgacaccggttctctatcaacggccacttctacaatcataagacctccgtg
tttactccagcctatggatccgtgaccaatgtgagggtcaacagcaccatgacaaccctg
caggtgctcaccctgctgctgaacaaatttagggtggaagatggccccagtgagttcgca
ctctacatcgttcacgagtctggggagcggacaaaattaaaagactgcgagtacccgctg
atttccagaatcctgcatgggccatgtgagaagatcgccaggatcttcctgatggaagct
gacttgggcgtggaagtcccccatgaagtcgctcagtacattaagtttgaaatgccggtg
ctggacagttttgttgaaaaattaaaagaagaggaagaaagagaaataatcaaactgacc
atgaagttccaagccctgcgtctgacgatgctgcagcgcctggagcagctggtggaggcc
aagtaa

KEGG   Homo sapiens (human): 9770
Entry
9770              CDS       T01001                                 
Symbol
RASSF2, CENP-34, RASFADIN
Name
(RefSeq) Ras association domain family member 2
  KO
K09851  Ras association domain-containing protein 2/4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04392 Hippo signaling pathway - multiple species
    9770 (RASSF2)
SSDB
Motif
Pfam: Nore1-SARAH RA DUF4125 Ras_bdg_2
Other DBs
NCBI-GeneID: 9770
NCBI-ProteinID: NP_055552
OMIM: 609492
HGNC: 9883
Ensembl: ENSG00000101265
Vega: OTTHUMG00000031790
Pharos: P50749(Tbio)
UniProt: P50749
LinkDB
Position
20:complement(4780023..4823608)
AA seq 326 aa
MDYSHQTSLVPCGQDKYISKNELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISW
GLRRPIRLQMQDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQ
MPSSTDSRGLKPLQEDTPQLMRTRSDVGVRRRGNVRTPSDQRRIRRHRFSINGHFYNHKT
SVFTPAYGSVTNVRINSTMTTPQVLKLLLNKFKIENSAEEFALYVVHTSGEKQKLKATDY
PLIARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEMPVLKSFIQKLQEEEDREVKK
LMRKYTVLRLMIRQRLEEIAETPATI
NT seq 981 nt   +upstreamnt  +downstreamnt
atggactacagccaccaaacgtccctagtcccatgtggacaagataaatacatttccaaa
aatgaacttctcttgcatctgaagacctacaacttgtactatgaaggccagaatttacag
ctccggcaccgggaggaagaagacgagttcattgtggaggggctcctgaacatctcctgg
ggcctgcgccggcccattcgcctgcagatgcaggatgacaacgaacgcattcgaccccct
ccatcctcctcctcctggcactctggctgtaacctgggggctcagggaaccactctgaag
cccctgactgtgcccaaagttcagatctcagaggtggatgccccgccggagggtgaccag
atgccaagctccacagactccaggggcctgaagcccctgcaggaggacaccccacagctg
atgcgcacacgcagtgatgttggggtgcgtcgccgtggcaatgtgaggacgcctagtgac
cagcggcgaatcagacgccaccgcttctccatcaacggccatttctacaaccataagaca
tccgtgttcacaccagcctatggctctgtcaccaacgtccgcatcaacagcaccatgacc
accccacaggtcctgaagctgctgctcaacaaatttaagattgagaattcagcagaggag
tttgccttgtacgtggtccatacgagtggtgagaaacagaagctgaaggccaccgattac
ccgctgattgcccgaatcctccagggcccatgtgagcagatctccaaagtgttcctaatg
gagaaggaccaggtggaggaagtcacctacgacgtggcccagtatataaagttcgagatg
ccggtacttaaaagcttcattcagaagctccaggaggaagaagatcgggaagtaaagaag
ctgatgcgcaagtacaccgtgctccggctaatgattcgacagaggctggaggagatagcc
gagaccccagcaacaatctga

DBGET integrated database retrieval system