KEGG   Homo sapiens (human): 83998
Entry
83998             CDS       T01001                                 
Symbol
REG4, GISP, REG-IV, RELP
Name
(RefSeq) regenerating family member 4
  KO
K22244  regenerating islet-derived protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05226  Gastric cancer
Network
nt06240  Transcription
nt06261  Gastric cancer
  Element
N00250  CDX2-overexpression to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09162 Cancer: specific types
   05226 Gastric cancer
    83998 (REG4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    83998 (REG4)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I63
   83998 (REG4)
SSDB
Motif
Pfam: Lectin_C
Other DBs
NCBI-GeneID: 83998
NCBI-ProteinID: NP_001152824
OMIM: 609846
HGNC: 22977
Ensembl: ENSG00000134193
Vega: OTTHUMG00000012175
Pharos: Q9BYZ8(Tbio)
UniProt: Q9BYZ8
Structure
LinkDB
Position
1:complement(119794017..119811460)
AA seq 158 aa
MASRSMRLLLLLSCLAKTGVLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQS
YGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSG
KSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP
NT seq 477 nt   +upstreamnt  +downstreamnt
atggcttccagaagcatgcggctgctcctattgctgagctgcctggccaaaacaggagtc
ctgggtgatatcatcatgagacccagctgtgctcctggatggttttaccacaagtccaat
tgctatggttacttcaggaagctgaggaactggtctgatgccgagctcgagtgtcagtct
tacggaaacggagcccacctggcatctatcctgagtttaaaggaagccagcaccatagca
gagtacataagtggctatcagagaagccagccgatatggattggcctgcacgacccacag
aagaggcagcagtggcagtggattgatggggccatgtatctgtacagatcctggtctggc
aagtccatgggtgggaacaagcactgtgctgagatgagctccaataacaactttttaact
tggagcagcaacgaatgcaacaagcgccaacacttcctgtgcaagtaccgaccatag

DBGET integrated database retrieval system