KEGG   Homo sapiens (human): 84068
Entry
84068             CDS       T01001                                 
Symbol
SLC10A7, C4orf13, P7, SSASKS
Name
(RefSeq) solute carrier family 10 member 7
  KO
K14347  solute carrier family 10 (sodium/bile acid cotransporter), member 7
Organism
hsa  Homo sapiens (human)
Disease
H02481  Syndromic disorder with short stature
Drug target
Maralixibat (DG02832): D10951
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    84068 (SLC10A7)
   04147 Exosome [BR:hsa04147]
    84068 (SLC10A7)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC10: Sodium bile salt cotransporter
   84068 (SLC10A7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   84068 (SLC10A7)
SSDB
Motif
Pfam: SBF_like SBF DUF3180
Other DBs
NCBI-GeneID: 84068
NCBI-ProteinID: NP_001025169
OMIM: 611459
HGNC: 23088
Ensembl: ENSG00000120519
Pharos: Q0GE19(Tdark)
UniProt: Q0GE19
LinkDB
Position
4:complement(146253981..146521940)
AA seq 340 aa
MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKT
EELTSALVHLKLHLFIQIFTLAFFPATIWLFLQLLSITPINEWLLKGLQTVGCMPPPVSS
AVILTKAVGGNEAAAIFNSAFGSFLGIVITPLLLLLFLGSSSSVPFTSIFSQLFMTVVVP
LIIGQIVRRYIKDWLERKKPPFGAISSSVLLMIIYTTFCDTFSNPNIDLDKFSLVLILFI
IFSIQLSFMLLTFIFSTRNNSGFTPADTVAIIFCSTHKSLTLGIPMLKIVFAGHEHLSLI
SVPLLIYHPAQILLGSVLVPTIKSWMVSRQKGVKLTRPTV
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgaggctgctggagagaatgaggaaagactggttcatggtcggaatagtgctggcgatc
gctggagctaaactggagccgtccataggggtgaatgggggaccactgaagccagaaata
actgtatcctacattgctgttgcaacaatattctttaacagtggactatcattgaaaaca
gaggagctgaccagtgctttggtgcatctaaaactgcatctttttattcagatctttact
cttgcattcttcccagcaacaatatggctttttcttcagcttttatcaatcacacccatc
aacgaatggcttttaaaaggtttgcagacagtaggttgcatgcctccgcctgtgtcttct
gcagtgattttaaccaaggcagttggtggaaatgaggcagctgcaatatttaattcagcc
tttggaagttttttgggcatcgttataacacccctgctcctgctgctttttcttggttca
tcttcttctgtgcctttcacatctattttttctcagctttttatgactgttgtggttcct
ctcatcattggacagattgtccgaagatacatcaaggattggcttgagagaaagaagcct
ccttttggtgctatcagcagcagtgtactcctcatgatcatctacacaacattctgtgac
acgttctctaacccaaatattgacctggataaattcagccttgttctcatactgttcata
atattttctatccagctgagttttatgcttttaactttcatcttttcaacaaggaataat
tcgggtttcacaccagcagacacagtggctatcattttctgttctacacacaaatccctt
acattgggaattccgatgctgaagatcgtgtttgcaggccatgagcatctctctttaata
tctgtacccttgctcatctaccacccagctcagatccttctgggaagtgtgttggtgcca
acaatcaagtcttggatggtatcaaggcagaagggagtgaagctgacaaggccgacagta
taa

DBGET integrated database retrieval system