KEGG   Homo sapiens (human): 84284
Entry
84284             CDS       T01001                                 
Symbol
NTPCR, C1orf57, HCR-NTPase, THEP1
Name
(RefSeq) nucleoside-triphosphatase, cancer-related
  KO
K06928  nucleoside-triphosphatase [EC:3.6.1.15]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00730  Thiamine metabolism
hsa01100  Metabolic pathways
hsa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    84284 (NTPCR)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    84284 (NTPCR)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.15  nucleoside-triphosphate phosphatase
     84284 (NTPCR)
SSDB
Motif
Pfam: NTPase_1 AAA_30 AAA_5 AAA_19 AAA_16 RNA_helicase AAA_18 AAA AAA_22 RuvB_N APS_kinase NACHT ATP_bind_1 MeaB AAA_24 AAA_14 ATPase_2 bpMoxR AAA_29 AAA_33 AAA_25 Mg_chelatase AAA_7 NB-ARC cobW AAA_3 Zeta_toxin AAA_28 MMR_HSR1 AAA_17 SRP54 IstB_IS21 TsaE
Other DBs
NCBI-GeneID: 84284
NCBI-ProteinID: NP_115700
HGNC: 28204
Ensembl: ENSG00000135778
Vega: OTTHUMG00000037822
Pharos: Q9BSD7(Tbio)
UniProt: Q9BSD7 Q5TDE9
Structure
LinkDB
Position
1:232950611..232983882
AA seq 190 aa
MARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRG
PLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMEL
FSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPD
IVTCVQSSRK
NT seq 573 nt   +upstreamnt  +downstreamnt
atggcccggcacgtgttcctaacggggcccccaggagttggaaaaacaacattgatccat
aaagccagtgaggttttaaaatcctctggtgtgcctgttgatggattttataccgaagaa
gtcagacagggagggagaagaataggattcgatgtcgtcacgttgtccggcacccggggg
cctttatcgagagttgggttagagcctccacctggaaaacgtgaatgccgagttgggcag
tatgtggtcgacctgacttcttttgagcagttggcactacccgtcttgaggaatgccgac
tgcagcagtggcccagggcaaagagtgtgcgtcatcgatgagattgggaagatggagctc
ttcagtcagcttttcattcaagctgttcgtcagacgctgtctaccccagggactataatc
cttggcacaatcccagttcctaaaggaaagccactggctcttgtagaagaaatcagaaac
agaaaggatgtgaaggtgtttaatgtcaccaaggaaaacagaaaccaccttctgccagat
atcgtgacgtgcgtgcagagcagcaggaagtga

DBGET integrated database retrieval system