Homo sapiens (human): 84337 Help Entry 84337             CDS       T01001                                  Symbol ELOF1, ELF1 Name (RefSeq) elongation factor 1   KO K25829   transcription elongation factor 1 Organism hsa  Homo sapiens (human) Brite KEGG Orthology (KO) [BR:hsa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:hsa03400]     84337 (ELOF1) DNA repair and recombination proteins [BR:hsa03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      Other TCR factor       84337 (ELOF1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_ribbon_Elf1 Lar_restr_allev SIR2 Motif Other DBs NCBI-GeneID:  84337 NCBI-ProteinID:  NP_115753 OMIM:  619818 HGNC:  28691 Ensembl:  ENSG00000130165 UniProt:  P60002 Structure PDBPDBj LinkDB All DBs Position 19:complement(11553046..11559230) Genome browser AA seq 83 aa AA seqDB search MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTP ITYLSEPVDVYSDWIDACEAANQ NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggggcgcagaaagtcaaaacgaaagccgcctcccaagaagaagatgacaggcaccctc gagacccagttcacctgccccttctgcaaccacgagaaatcctgtgatgtgaaaatggac cgtgcccgcaacaccggagtcatctcttgtaccgtgtgcctagaggaattccagacgccc ataacgtatctgtcagaacccgtggatgtgtacagtgattggatagacgcctgcgaggcg gccaatcagtag

DBGET integrated database retrieval system