KEGG   Homo sapiens (human): 84432
Entry
84432             CDS       T01001                                 
Symbol
PROK1, EGVEGF, PK1, PRK1
Name
(RefSeq) prokineticin 1
  KO
K24191  prokineticin
Organism
hsa  Homo sapiens (human)
Network
nt06361  Hypogonadotropic hypogonadism
  Element
N00879  PROK-PRKR-Gi-ERK signaling pathway
N00881  Mutation-inactivated PROKR2 to PROK-PRKR-Gi-ERK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    84432 (PROK1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   84432 (PROK1)
SSDB
Motif
Pfam: Prokineticin
Other DBs
NCBI-GeneID: 84432
NCBI-ProteinID: NP_115790
OMIM: 606233
HGNC: 18454
Ensembl: ENSG00000143125
Pharos: P58294(Tbio)
UniProt: P58294 A0A024R0B1
LinkDB
Position
1:110451149..110457358
AA seq 105 aa
MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEEC
HPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
NT seq 318 nt   +upstreamnt  +downstreamnt
atgagaggtgccacgcgagtctcaatcatgctcctcctagtaactgtgtctgactgtgct
gtgatcacaggggcctgtgagcgggatgtccagtgtggggcaggcacctgctgtgccatc
agcctgtggcttcgagggctgcggatgtgcaccccgctggggcgggaaggcgaggagtgc
caccccggcagccacaaggtccccttcttcaggaaacgcaagcaccacacctgtccttgc
ttgcccaacctgctgtgctccaggttcccggacggcaggtaccgctgctccatggacttg
aagaacatcaatttttag

KEGG   Homo sapiens (human): 60675
Entry
60675             CDS       T01001                                 
Symbol
PROK2, BV8, HH4, KAL4, MIT1, PK2
Name
(RefSeq) prokineticin 2
  KO
K24191  prokineticin
Organism
hsa  Homo sapiens (human)
Network
nt06361  Hypogonadotropic hypogonadism
  Element
N00879  PROK-PRKR-Gi-ERK signaling pathway
N00880  Mutation-inactivated PROK2 to PROK-PRKR-Gi-ERK signaling pathway
N00881  Mutation-inactivated PROKR2 to PROK-PRKR-Gi-ERK signaling pathway
Disease
H00255  Hypogonadotropic hypogonadism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    60675 (PROK2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   60675 (PROK2)
SSDB
Motif
Pfam: Prokineticin MIT_LIKE_ACTX
Other DBs
NCBI-GeneID: 60675
NCBI-ProteinID: NP_001119600
OMIM: 607002
HGNC: 18455
Ensembl: ENSG00000163421
Pharos: Q9HC23(Tbio)
UniProt: Q9HC23
LinkDB
Position
3:complement(71771655..71785148)
AA seq 129 aa
MRSLCCAPLLLLLLLPPLLLTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTP
MGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHTCPCLPGLACLRTSF
NRFICLAQK
NT seq 390 nt   +upstreamnt  +downstreamnt
atgaggagcctgtgctgcgccccactcctgctcctcttgctgctgccgccgctgctgctc
acgccccgcgctggggacgccgccgtgatcaccggggcttgtgacaaggactcccaatgt
ggtggaggcatgtgctgtgctgtcagtatctgggtcaagagcataaggatttgcacacct
atgggcaaactgggagacagctgccatccactgactcgtaaaaacaattttggaaatgga
aggcaggaaagaagaaagaggaagagaagcaaaaggaaaaaggaggttccattttttggg
cggaggatgcatcacacttgcccatgtctgccaggcttggcctgtttacggacttcattt
aaccgatttatttgtttagcccaaaagtaa

DBGET integrated database retrieval system