KEGG   Homo sapiens (human): 84455
Entry
84455             CDS       T01001                                 

Symbol
EFCAB7
Name
(RefSeq) EF-hand calcium binding domain 7
  KO
K23852  EF-hand calcium-binding domain-containing protein 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    84455 (EFCAB7)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_4 EF-hand_5 DUF1919 EF_assoc_2 EFhand_Ca_insen Dockerin_1 DUF4891
Other DBs
NCBI-GeneID: 84455
NCBI-ProteinID: NP_115813
OMIM: 617632
HGNC: 29379
Ensembl: ENSG00000203965
Vega: OTTHUMG00000008983
Pharos: A8K855(Tdark)
UniProt: A8K855
LinkDB
Position
1p31.3
AA seq 629 aa
MAISPRSDATFSSQKSTPSESPRTKKFPLTEEEIFYMNCRAAYLTVFKSSLENIISKDQL
YLALQHAGRNPSQKTINKYWTPQTAKLNFDDFCIILRKEKPTSKAELLKSFKQLDVNDDG
CILHTDLYKFLTKRGEKMTREEVNAIINLADVNADGKFDYIKFCKLYMTTNEQCLKTTLE
KLEVDSKLMRHQFGNHIEGSPERDPSPVPKPSPKITRKTDPETFLNKGDTRSSLLSATRK
FKTSVSFTVTMGANGNRNSKLMEPNLIKDWQHMQSKGCFFLEEDGEIISHQYRMQIAQRS
MVYLTIKPLNLSQVEGKPSPWLSVDTALYILKENESQANLQLVCFTELRNREVFGWTGEL
GPGIYWLIPSTTGCRLRKKIKPVTDEAQLVYRDETGELFLTKEFKSTLSDIFEVIDLDGN
GLLSLEEYNFFELRTSGEKCDEDAWAVCRENFDTKRNELTRQGFMDLNLMEANDREGDPC
DLWVTLHSMGYNKALELTEACPFVIDIYAEKCKPKIKAVHMEACSGQLEKAICKSVLSNG
DAKVMDGYENIIVHTYSCDTWITSVIENKSDEKVIIHISNELSKNCINNRGLNIFAVEVG
PKSTMVCQHVMPLNERQEWIYYCIYSLIS
NT seq 1890 nt   +upstreamnt  +downstreamnt
atggcgatcagtccacgaagcgatgcaactttctccagtcagaaatcaacaccttcagag
agtcctcgaacaaagaaatttccactaactgaagaggaaatattttatatgaattgtaga
gctgcctacttaactgtcttcaaaagcagcttggaaaacattatttctaaagatcaactt
tacttagctcttcagcatgcaggaagaaatccatcccaaaagaccattaataagtattgg
actcctcaaactgccaaactgaattttgatgatttttgtataattttaaggaaggaaaaa
cctacttcaaaagcagaactactaaaatcatttaagcaattagatgtaaatgatgatggc
tgtattttacacactgacctttataaatttctaacaaagagaggtgagaagatgactcga
gaagaagtaaatgccataataaatttggctgatgtaaatgctgatggcaaatttgactac
atcaagttttgtaaattatatatgacaaccaacgagcaatgtctcaagactacactagaa
aaactagaggttgacagtaaattgatgcgtcaccagtttggaaaccacatcgaagggtcc
cctgaaagggacccatcaccagtaccaaaaccatcacctaaaatcacaagaaaaactgat
ccagaaacattcttaaataaaggtgacaccaggagttctttactgtcagcaaccaggaag
ttcaaaacatctgtttccttcacagttaccatgggggctaatggtaaccgaaactcaaag
ttaatggagccaaatttaataaaggactggcaacacatgcaatcaaaaggttgcttcttc
ttagaagaagatggtgaaatcattagtcatcagtacaggatgcaaatagctcagaggtcc
atggtttatctaacaattaagccattaaacctgagtcaagttgaaggaaaaccatcccct
tggttatccgttgatactgccttgtatattctcaaggaaaatgagagtcaagcaaatcta
cagcttgtgtgttttaccgaactacgaaatagagaagtgtttggatggactggtgaacta
ggacctggaatttactggttaattccttccacaactggctgtaggctgaggaaaaaaata
aaaccagtaacagatgaagcccaacttgtatatagagatgaaacaggggaattattcctt
acaaaggaatttaagtctactttatcagatatatttgaagtaattgatttagatggaaat
ggtcttcttagccttgaagaatataatttttttgaattgagaacaagtggtgagaaatgt
gatgaagatgcttgggctgtctgcagagagaattttgatacaaagaggaatgaactaaca
agacaaggatttatggatttgaatctaatggaagctaatgatcgagaaggagatccttgt
gacctttgggtaactctacactctatgggctacaataaagctctggagttgacagaggca
tgtccatttgtcattgatatctatgcagaaaaatgcaagccaaaaattaaagctgtccat
atggaggcatgtagtggacaacttgagaaggccatttgtaaatctgttcttagcaacggt
gatgccaaagtaatggatggctatgaaaatataatcgtgcatacttacagttgtgacacc
tggataacgtcagttattgaaaacaagtcagatgagaaagtgattattcacatcagcaat
gagctaagtaaaaactgcataaacaacagaggactcaacatatttgcagtagaagtggga
cccaaatctacaatggtttgtcaacatgtaatgcctttgaatgaacgacaagaatggata
tattattgtatatattctcttatttcttaa

DBGET integrated database retrieval system