KEGG   Homo sapiens (human): 84516
Entry
84516             CDS       T01001                                 

Gene name
DCTN5
Definition
(RefSeq) dynactin subunit 5
  KO
K10427  dynactin 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04962  Vasopressin-regulated water reabsorption
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
N01295  Rab7-regulated microtubule minus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    84516 (DCTN5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    84516 (DCTN5)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    84516 (DCTN5)
   05016 Huntington disease
    84516 (DCTN5)
   05022 Pathways of neurodegeneration - multiple diseases
    84516 (DCTN5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    84516 (DCTN5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    84516 (DCTN5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     84516 (DCTN5)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     84516 (DCTN5)
SSDB
Motif
Pfam: Hexapep Hexapep_2 DUF4954 Fucokinase
Other DBs
NCBI-GeneID: 84516
NCBI-ProteinID: NP_115875
OMIM: 612962
HGNC: 24594
Ensembl: ENSG00000166847
Vega: OTTHUMG00000131610
Pharos: Q9BTE1(Tdark)
UniProt: Q9BTE1
LinkDB
Position
16p12.2
AA seq 182 aa
MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRH
CVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRC
VLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLT
QV
NT seq 549 nt   +upstreamnt  +downstreamnt
atggagttgggcgagctgctctacaacaagtctgagtacatcgagacggcatctgggaac
aaagtcagtcgccagtcagtgttgtgtggaagccagaacatcgttctcaatggcaagacc
attgtgatgaatgactgtattatccgaggggatctggcaaatgtaagagttggacgtcat
tgtgttgtgaaaagtcgtagtgtcataaggccaccattcaagaagttcagcaaaggtgtt
gcattctttcctttacatattggagaccatgtctttattgaggaagattgtgtggtcaac
gcagcacagattggttcctatgttcatgttgggaagaactgtgtgattgggcgccgatgt
gtgttgaaagactgctgcaaaattcttgacaacacagtattacctccagaaactgtggtt
ccaccattcactgtcttctcaggctgcccaggactcttctcaggggagctcccggagtgc
actcaggagctgatgattgacgtcaccaagagctactaccagaagtttttgcccctgacg
caagtctag

DBGET integrated database retrieval system