KEGG   Homo sapiens (human): 8493Help
Entry
8493              CDS       T01001                                 

Gene name
PPM1D, IDDGIP, PP2C-DELTA, WIP1
Definition
(RefSeq) protein phosphatase, Mg2+/Mn2+ dependent 1D
  KO
K10147  protein phosphatase 1D [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    8493 (PPM1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    8493 (PPM1D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     8493 (PPM1D)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    8493 (PPM1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PP2C PP2C_2
Motif
Other DBs
NCBI-GeneID: 8493
NCBI-ProteinID: NP_003611
OMIM: 605100
HGNC: 9277
Ensembl: ENSG00000170836
Vega: OTTHUMG00000180052
Pharos: O15297(Tchem)
UniProt: O15297 A0A0S2Z4M2
LinkDB All DBs
Position
17q23.2
AA seq 605 aa AA seqDB search
MAGLYSLGVSVFSDQGGRKYMEDVTQIVVEPEPTAEEKPSPRRSLSQPLPPRPSPAALPG
GEVSGKGPAVAAREARDPLPDAGASPAPSRCCRRRSSVAFFAVCDGHGGREAAQFAREHL
WGFIKKQKGFTSSEPAKVCAAIRKGFLACHLAMWKKLAEWPKTMTGLPSTSGTTASVVII
RGMKMYVAHVGDSGVVLGIQDDPKDDFVRAVEVTQDHKPELPKERERIEGLGGSVMNKSG
VNRVVWKRPRLTHNGPVRRSTVIDQIPFLAVARALGDLWSYDFFSGEFVVSPEPDTSVHT
LDPQKHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQ
RMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLTDSPSYNSQETCVMTPSPCSTPPVK
SLEEDPWPRVNSKDHIPALVRSNAFSENFLEVSAEIARENVQGVVIPSKDPEPLEENCAK
ALTLRIHDSLNNSLPIGLVPTNSTNTVMDQKNLKMSTPGQMKAQEIERTPPTNFKRTLEE
SNSGPLMKKHRRNGLSRSSGAQPASLPTTSQRKNSVKLTMRRRLRGQKKIGNPLLHQHRK
TVCVC
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggcggggctgtactcgctgggagtgagcgtcttctccgaccagggcgggaggaagtac
atggaggacgttactcaaatcgttgtggagcccgaaccgacggctgaagaaaagccctcg
ccgcggcggtcgctgtctcagccgttgcctccgcggccgtcgccggccgcccttcccggc
ggcgaagtctcggggaaaggcccagcggtggcagcccgagaggctcgcgaccctctcccg
gacgccggggcctcgccggcacctagccgctgctgccgccgccgttcctccgtggccttt
ttcgccgtgtgcgacgggcacggcgggcgggaggcggcacagtttgcccgggagcacttg
tggggtttcatcaagaagcagaagggtttcacctcgtccgagccggctaaggtttgcgct
gccatccgcaaaggctttctcgcttgtcaccttgccatgtggaagaaactggcggaatgg
ccaaagactatgacgggtcttcctagcacatcagggacaactgccagtgtggtcatcatt
cggggcatgaagatgtatgtagctcacgtaggtgactcaggggtggttcttggaattcag
gatgacccgaaggatgactttgtcagagctgtggaggtgacacaggaccataagccagaa
cttcccaaggaaagagaacgaatcgaaggacttggtgggagtgtaatgaacaagtctggg
gtgaatcgtgtagtttggaaacgacctcgactcactcacaatggacctgttagaaggagc
acagttattgaccagattccttttctggcagtagcaagagcacttggtgatttgtggagc
tatgatttcttcagtggtgaatttgtggtgtcacctgaaccagacacaagtgtccacact
cttgaccctcagaagcacaagtatattatattggggagtgatggactttggaatatgatt
ccaccacaagatgccatctcaatgtgccaggaccaagaggagaaaaaatacctgatgggt
gagcatggacaatcttgtgccaaaatgcttgtgaatcgagcattgggccgctggaggcag
cgtatgctccgagcagataacactagtgccatagtaatctgcatctctccagaagtggac
aatcagggaaactttaccaatgaagatgagttatacctgaacctgactgacagcccttcc
tataatagtcaagaaacctgtgtgatgactccttccccatgttctacaccaccagtcaag
tcactggaggaggatccatggccaagggtgaattctaaggaccatatacctgccctggtt
cgtagcaatgccttctcagagaattttttagaggtttcagctgagatagctcgagagaat
gtccaaggtgtagtcataccctcaaaagatccagaaccacttgaagaaaattgcgctaaa
gccctgactttaaggatacatgattctttgaataatagccttccaattggccttgtgcct
actaattcaacaaacactgtcatggaccaaaaaaatttgaagatgtcaactcctggccaa
atgaaagcccaagaaattgaaagaacccctccaacaaactttaaaaggacattagaagag
tccaattctggccccctgatgaagaagcatagacgaaatggcttaagtcgaagtagtggt
gctcagcctgcaagtctccccacaacctcacagcgaaagaactctgttaaactcaccatg
cgacgcagacttaggggccagaagaaaattggaaatcctttacttcatcaacacaggaaa
actgtttgtgtttgctga

DBGET integrated database retrieval system