KEGG   Homo sapiens (human): 84976
Entry
84976             CDS       T01001                                 
Symbol
DISP1, DISPA
Name
(RefSeq) dispatched RND transporter family member 1
  KO
K24680  protein dispatched 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
Network
nt06501  HH signaling
  Element
N01537  Hedgehog signaling pathway, HH ligand secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    84976 (DISP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    84976 (DISP1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Other domain-containing proteins
  Patched domain-containing proteins
   84976 (DISP1)
SSDB
Motif
Pfam: Patched MMPL Sterol-sensing
Other DBs
NCBI-GeneID: 84976
NCBI-ProteinID: NP_116279
OMIM: 607502
HGNC: 19711
Ensembl: ENSG00000154309
Pharos: Q96F81(Tbio)
UniProt: Q96F81
Structure
LinkDB
Position
1:222815039..223005995
AA seq 1524 aa
MAMSNGNNDFVVLSNSSIATSAANPSPLTPCDGDHAAQQLTPKEATRTKVSPNGCLQLNG
TVKSSFLPLDNQRMPQMLPQCCHPCPYHHPLTSHSSHQECHPEAGPAAPSALASCCMQPH
SEYSASLCPNHSPVYQTTCCLQPSPSFCLHHPWPDHFQHQPVQQHIANIRPSRPFKLPKS
YAALIADWPVVVLGMCTMFIVVCALVGVLVPELPDFSDPLLGFEPRGTAIGQRLVTWNNM
VKNTGYKATLANYPFKYADEQAKSHRDDRWSDDHYEREKREVDWNFHKDSFFCDVPSDRY
SRVVFTSSGGETLWNLPAIKSMCNVDNSRIRSHPQFGDLCQRTTAASCCPSWTLGNYIAI
LNNRSSCQKIVERDVSHTLKLLRTCAKHYQNGTLGPDCWDMAARRKDQLKCTNVPRKCTK
YNAVYQILHYLVDKDFMTPKTADYATPALKYSMLFSPTEKGESMMNIYLDNFENWNSSDG
VTTITGIEFGIKHSLFQDYLLMDTVYPAIAIVIVLLVMCVYTKSMFITLMTMFAIISSLI
VSYFLYRVVFHFEFFPFMNLTALIILVGIGADDAFVLCDVWNYTKFDKPHAETSETVSIT
LQHAALSMFVTSFTTAAAFYANYVSNITAIRCFGVYAGTAILVNYVLMVTWLPAVVVLHE
RYLLNIFTCFKKPQQQIYDNKSCWTVACQKCHKVLFAISEASRIFFEKVLPCIVIKFRYL
WLFWFLALTVGGAYIVCINPKMKLPSLELSEFQVFRSSHPFERYDAEYKKLFMFERVHHG
EELHMPITVIWGVSPEDNGNPLNPKSKGKLTLDSSFNIASPASQAWILHFCQKLRNQTFF
YQTDEQDFTSCFIETFKQWMENQDCDEPALYPCCSHWSFPYKQEIFELCIKRAIMELERS
TGYHLDSKTPGPRFDINDTIRAVVLEFQSTYLFTLAYEKMHQFYKEVDSWISSELSSAPE
GLSNGWFVSNLEFYDLQDSLSDGTLIAMGLSVAVAFSVMLLTTWNIIISLYAIISIAGTI
FVTVGSLVLLGWELNVLESVTISVAVGLSVDFAVHYGVAYRLAPDPDREGKVIFSLSRVG
SAMAMAALTTFVAGAMMMPSTVLAYTQLGTFMMLIMCISWAFATFFFQCMCRCLGPQGTC
GQIPLPKKLQCSAFSHALSTSPSDKGQSKTHTINAYHLDPRGPKSELEHEFYELEPLASH
SCTAPEKTTYEETHICSEFFNSQAKNLGMPVHAAYNSELSKSTESDAGSALLQPPLEQHT
VCHFFSLNQRCSCPDAYKHLNYGPHSCQQMGDCLCHQCSPTTSSFVQIQNGVAPLKATHQ
AVEGFVHPITHIHHCPCLQGRVKPAGMQNSLPRNFFLHPVQHIQAQEKIGKTNVHSLQRS
IEEHLPKMAEPSSFVCRSTGSLLKTCCDPENKQRELCKNRDVSNLESSGGTENKAGGKVE
LSLSQTDASVNSEHFNQNEPKVLFNHLMGEAGCRSCPNNSQSCGRIVRVKCNSVDCQMPN
MEANVPAVLTHSELSGESLLIKTL
NT seq 4575 nt   +upstreamnt  +downstreamnt
atggctatgagcaatggaaacaatgattttgtggttctgagcaacagcagcatcgcaacc
agtgctgctaacccgagtcccctcaccccctgtgatggagaccatgcagcccagcagctc
acacccaaagaagcaacaagaacaaaagtgagtccaaatggatgcctgcaacttaatggc
acggtcaaatcatcctttctgcctttagacaaccaaagaatgcctcagatgttaccccaa
tgctgccatccttgcccataccatcaccctttgactagccatagcagtcaccaagagtgc
catcccgaggctggccctgcagcaccctctgctttggcctcgtgttgcatgcagccacac
tccgagtattctgcatctctttgtccaaatcattcacctgtgtatcagactacgtgctgt
cttcagccctctccatccttctgcctgcatcatccgtggcctgaccattttcagcatcag
cctgtgcaacagcacatagccaacataagaccatccagacctttcaagttgccaaaaagt
tatgcagccctgatagccgactggccggtggtggtcttgggcatgtgcaccatgttcatc
gtagtctgtgccttggttggagtattagtgccagagctccctgacttctctgatccattg
ctgggttttgaaccaagaggaacagcaataggccagagattggtcacatggaataatatg
gtgaaaaatacaggatacaaagcaacattagcaaattatccctttaaatatgcagatgaa
caagccaaaagccatcgggatgatagatggtcagatgatcattatgaaagagagaaaaga
gaagttgactggaacttccacaaggacagctttttctgcgacgttccaagtgaccgatat
tccagagtggtatttacttcatctggaggggagacattatggaatttacctgcaattaaa
tcaatgtgcaatgtagataattccaggatcagatctcatccccagtttggtgatctctgc
cagaggaccactgctgcctcctgctgccccagctggacactgggaaactacatcgccatt
ctgaacaatagatcgtcctgtcagaaaatagttgagcgagacgtttctcataccttgaag
ctgcttcggacttgtgccaaacactaccaaaatggcactctggggccagactgctgggac
atggcagccagaagaaaggaccagctcaagtgcaccaatgtgccacgcaaatgtaccaag
tacaatgctgtgtaccagatcctccattacttggtggacaaagactttatgaccccaaag
acggctgactatgccacgccagctttaaaatacagcatgctcttctctcccacagagaaa
ggggagagcatgatgaacatttacttggacaactttgaaaactggaactcttctgacggc
gtgactaccatcaccgggattgagtttggtatcaaacacagtttgtttcaggattatctt
ctaatggatactgtgtatcctgccatagccattgtgattgtccttttagttatgtgtgtc
tacaccaagtccatgtttatcactctgatgacaatgtttgcaataatcagttctttgatt
gtttcctattttctctatcgtgtagtatttcacttcgaattttttccttttatgaacctc
actgccctcattattttggttggaattggagcagatgatgcttttgtcctgtgtgatgtt
tggaactacacaaaatttgataagcctcatgccgaaacctcagaaacagtaagcatcacc
ttgcagcacgctgccctctccatgttcgtcaccagttttaccactgctgctgccttttat
gctaactatgttagcaacattacagcaatccgatgctttggggtttatgcggggacagct
atattggtgaattacgttttgatggtcacatggcttccagcagttgttgtgctgcatgag
cggtatcttcttaatatattcacttgcttcaaaaagccccagcagcaaatatatgataac
aaaagctgctggacagtggcttgccagaagtgccacaaagtactctttgccatttcagaa
gcatctcgaatttttttcgaaaaagtattgccatgcattgtcattaagtttcgctacctt
tggctgttttggttccttgccttaactgtaggtggggcctacattgtatgtataaatcca
aagatgaaactgccctcactggagttatccgagttccaggtgttccggtcgtcccatcct
tttgagcgttatgatgctgaatacaaaaagcttttcatgtttgaacgtgttcaccatggc
gaggagctccacatgcccatcacagtaatctggggcgtgtccccagaagacaatggcaac
ccactaaatcccaagagtaaagggaagttgacattagatagcagttttaacatcgccagc
ccagcttcccaggcctggattttgcacttctgtcaaaaactgagaaaccaaacattcttt
taccagactgatgaacaggacttcaccagctgcttcattgagacattcaaacagtggatg
gaaaaccaggactgtgatgagcctgccctgtacccatgctgcagccactggagcttcccc
tacaagcaagagatttttgaactgtgcatcaagagagctatcatggagctggaaaggagt
acagggtaccatttggatagcaaaaccccagggccgaggtttgatatcaatgatactatc
agggcagtggtgttagagttccagagtacctacctcttcacactggcttatgaaaagatg
catcagttttataaagaggtggactcgtggatatccagtgagctgagttcggcccctgaa
ggcctcagcaatggttggtttgtcagcaatctggagttctatgacctccaggatagcctc
tccgatggcaccctcattgccatggggctgtcagttgctgttgcatttagcgtgatgctg
ctgacaacttggaacatcatcataagcctttatgccatcatttcaattgctggaacgata
tttgtcactgttggttctcttgtcctgctgggctgggagctcaatgtgttggaatctgtc
accatttcggttgccgtcggcttgtctgtagactttgccgtccattatggggttgcctac
cgcttggctccagatcccgaccgagaaggcaaagtgatcttctctctgagtcgcgtgggc
tctgcgatggccatggctgccctgaccaccttcgtggcaggggccatgatgatgccctcc
acagttctagcttacacccagctgggcaccttcatgatgctcatcatgtgtatcagttgg
gctttcgccaccttctttttccagtgcatgtgccggtgccttggaccacagggtacctgt
ggtcagattcctttacctaaaaaactacagtgcagtgccttttcccatgccttgtctaca
agtcccagtgacaagggacaaagcaaaacacataccataaatgcttatcatttagatccc
aggggcccaaaatctgaactggagcatgagttttatgaattagaacctctggcttcccac
agctgcactgcccctgagaagaccacttatgaagagacccacatctgctctgaatttttc
aacagccaagcaaagaatttagggatgcctgtgcatgcagcttacaacagtgaactcagc
aaaagcactgaaagtgacgctggctctgccttgttacagccccctcttgaacagcatacc
gtgtgtcacttcttctctctgaatcagagatgtagctgcccagatgcctacaaacacttg
aactatggcccacactcttgccagcagatgggggactgcttgtgccaccagtgctctcct
accactagcagctttgtccagatccaaaacggcgtggcacctctgaaggccacacaccaa
gctgtcgagggctttgtgcaccccatcacgcacatccaccactgtccctgcctgcagggc
agagtaaagccagccggaatgcagaattctctgcctaggaattttttcctccacccagtg
cagcacattcaggcccaagaaaaaattggcaagaccaatgtacacagtcttcagaggagc
atagaagagcatcttccaaagatggcagagccatcgtcatttgtctgcagaagcactgga
tcgttactcaaaacgtgttgcgaccccgagaataaacaaagggaactctgtaaaaataga
gacgtgagcaatctggagagcagtggagggactgaaaacaaggcaggagggaaagtggag
ctgagcttgtcacagacggatgcaagtgtgaactcagaacatttcaatcagaatgaacca
aaagtcctatttaatcatttaatgggggaggctggttgtaggtcttgcccaaataattca
caaagttgtggcagaattgtgagagtgaagtgcaattctgtggactgtcaaatgccaaac
atggaagccaatgtgcctgctgtattaacacactcggaactttctggtgaaagtttgtta
ataaaaacactataa

DBGET integrated database retrieval system