KEGG   Homo sapiens (human): 85015
Entry
85015             CDS       T01001                                 
Symbol
USP45, LCA19
Name
(RefSeq) ubiquitin specific peptidase 45
  KO
K11844  ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Disease
H00837  Leber congenital amaurosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    85015 (USP45)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    85015 (USP45)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     85015 (USP45)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   85015 (USP45)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    85015 (USP45)
SSDB
Motif
Pfam: UCH zf-UBP Rrp44_CSD1 LELP1
Other DBs
NCBI-GeneID: 85015
NCBI-ProteinID: NP_001073950
OMIM: 618439
HGNC: 20080
Ensembl: ENSG00000123552
Pharos: Q70EL2(Tbio)
UniProt: Q70EL2
LinkDB
Position
6:complement(99432325..99517846)
AA seq 814 aa
MRVKDPTKALPEKAKRSKRPTVPHDEDSSDDIAVGLTCQHVSHAISVNHVKRAIAENLWS
VCSECLKERRFYDGQLVLTSDIWLCLKCGFQGCGKNSESQHSLKHFKSSRTEPHCIIINL
STWIIWCYECDEKLSTHCNKKVLAQIVDFLQKHASKTQTSAFSRIMKLCEEKCETDEIQK
GGKCRNLSVRGITNLGNTCFFNAVMQNLAQTYTLTDLMNEIKESSTKLKIFPSSDSQLDP
LVVELSRPGPLTSALFLFLHSMKETEKGPLSPKVLFNQLCQKAPRFKDFQQQDSQELLHY
LLDAVRTEETKRIQASILKAFNNPTTKTADDETRKKVKAYGKEGVKMNFIDRIFIGELTS
TVMCEECANISTVKDPFIDISLPIIEERVSKPLLWGRMNKYRSLRETDHDRYSGNVTIEN
IHQPRAAKKHSSSKDKSQLIHDRKCIRKLSSGETVTYQKNENLEMNGDSLMFASLMNSES
RLNESPTDDSEKEASHSESNVDADSEPSESESASKQTGLFRSSSGSGVQPDGPLYPLSAG
KLLYTKETDSGDKEMAEAISELRLSSTVTGDQDFDRENQPLNISNNLCFLEGKHLRSYSP
QNAFQTLSQSYITTSKECSIQSCLYQFTSMELLMGNNKLLCENCTKNKQKYQEETSFAEK
KVEGVYTNARKQLLISAVPAVLILHLKRFHQAGLSLRKVNRHVDFPLMLDLAPFCSATCK
NASVGDKVLYGLYGIVEHSGSMREGHYTAYVKVRTPSRKLSEHNTKKKNVPGLKAADNES
AGQWVHVSDTYLQVVPESRALSAQAYLLFYERVL
NT seq 2445 nt   +upstreamnt  +downstreamnt
atgcgggtgaaagatccaactaaagctttacctgagaaagccaaaagaagtaaaaggcct
actgtacctcatgatgaagactcttcagatgatattgctgtaggtttaacttgccaacat
gtaagtcatgctatcagcgtgaatcatgtaaagagagcaatagctgagaatctgtggtca
gtttgctcagaatgtttaaaagaaagaagattctatgatgggcagctagtacttacttct
gatatttggttgtgcctcaagtgtggcttccagggatgtggtaaaaactcagaaagccaa
cattcattgaagcactttaagagttccagaacagagccccattgtattataattaatctg
agcacatggattatatggtgttatgaatgtgatgaaaaattatcaacgcattgtaataag
aaggttttggctcagatagttgattttctccagaaacatgcttctaaaacacaaacaagt
gcattttctagaatcatgaaactttgtgaagaaaaatgtgaaacagatgaaatacagaag
ggaggaaaatgcagaaatttatctgtaagaggaattacaaatttaggaaatacttgcttt
tttaatgcagtcatgcagaacttggcacagacttatactcttactgatctgatgaatgag
atcaaagaaagtagtacaaaactcaagatttttccttcctcagactctcagctggaccca
ttggtggtggaactttcaaggcctggaccactgacctcagccttgttcctgtttcttcac
agcatgaaggagactgaaaaaggaccactttctcctaaagttctttttaatcagctttgt
cagaaggcacctcgatttaaagatttccagcaacaggacagtcaggagcttcttcattat
cttctggatgcagtgaggacagaagaaacaaagcgaatacaagctagcattctaaaagca
tttaacaacccaactactaaaactgctgatgatgaaactagaaaaaaagtcaaagcatat
ggaaaagaaggtgtgaaaatgaacttcatagatcggatctttattggtgaattaactagc
acggtcatgtgtgaagaatgtgcaaatatctccacggtgaaagatccattcattgatatt
tcacttcctataatagaagaaagggtttcaaaacctttactttggggaagaatgaataaa
tatagaagtttacgggagacagatcatgatcgatacagtggcaatgttactatagaaaat
attcatcaacctagagctgccaagaagcattcttcatctaaagataagagtcaactaatt
catgaccgaaaatgtattagaaaattgtcatctggagaaactgtcacataccagaaaaat
gaaaaccttgaaatgaatggggattctttaatgtttgccagcctcatgaattctgagtca
cgtctgaatgaaagccctactgatgacagtgaaaaagaagccagccattctgaaagcaat
gttgatgctgacagtgagccttcagaatctgaaagtgcttcaaagcagactgggctgttc
agatccagtagtggatccggtgtgcagccagatggacccctttaccctctgtcagcaggt
aaactgctgtacaccaaggagactgacagtggtgataaggaaatggcagaagctatttct
gaacttcgtttgagcagcactgtaactggagatcaagattttgacagagaaaatcagcca
ctaaatatttcaaataatttatgttttttagaggggaagcatttgaggtcttatagtccc
caaaatgcttttcagaccctttctcagagctatataactacttctaaagaatgttcaatt
cagtcctgtctctaccagtttacatctatggaattactaatggggaataataagcttcta
tgtgagaattgtactaaaaacaaacagaagtaccaagaagaaaccagttttgcagaaaag
aaagtagaaggagtttatactaatgccaggaagcaattgctcatttctgctgttccagct
gtcctaattctccacctgaaaagatttcatcaggctggcttgagtcttcgtaaagtaaac
agacatgtagattttccacttatgctcgatttagcaccattctgctctgctacttgtaag
aatgcaagtgtgggagataaagttctctacggtctctatggcatagtggaacatagtggc
tcgatgagagaaggccactacactgcttatgtgaaagtgagaacaccctccaggaaatta
tcggaacataacactaaaaagaaaaatgtgcctggtttgaaagcggctgataatgaatca
gcaggccagtgggtccatgttagtgacacttacttacaggtggttccagaatcaagagca
cttagtgcacaagcctaccttcttttctatgaaagagtattataa

DBGET integrated database retrieval system