KEGG   Homo sapiens (human): 8520
Entry
8520              CDS       T01001                                 
Symbol
HAT1, KAT1
Name
(RefSeq) histone acetyltransferase 1
  KO
K11303  histone acetyltransferase 1 [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    8520 (HAT1)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    8520 (HAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8520 (HAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     8520 (HAT1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    8520 (HAT1)
   HAT complexes
    HATB complex
     8520 (HAT1)
SSDB
Motif
Pfam: Hat1_N Acetyltransf_7 Acetyltransf_10 Acetyltransf_1 DUF5344
Other DBs
NCBI-GeneID: 8520
NCBI-ProteinID: NP_003633
OMIM: 603053
HGNC: 4821
Ensembl: ENSG00000128708
Pharos: O14929(Tbio)
UniProt: O14929
Structure
LinkDB
Position
2:171922461..171983686
AA seq 419 aa
MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLF
GDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFC
TNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQT
FLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQ
MLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCF
SREKLMQGFNEDMVIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLI
SPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggcgggatttggtgctatggagaaatttttggtagaatataagagtgcagtggagaag
aaactggcagagtacaaatgtaacaccaacacagcaattgaactaaaattagttcgtttt
cctgaagatcttgaaaatgacattagaactttctttcctgagtatacccatcaactcttt
ggggatgatgaaactgcttttggttacaagggtctaaagatcctgttatactatattgct
ggtagcctgtcaacaatgttccgtgttgaatatgcatctaaagttgatgagaactttgac
tgtgtagaggcagatgatgttgagggcaaaattagacaaatcattccacctggattttgc
acaaacacgaatgatttcctttctttactggaaaaggaagttgatttcaagccattcgga
accttacttcatacctactcagttctcagtccaacaggaggagaaaactttacctttcag
atatataaggctgacatgacatgtagaggctttcgagaatatcatgaaaggcttcagacc
tttttgatgtggtttattgaaactgctagctttattgacgtggatgatgaaagatggcac
tactttctagtatttgagaagtataataaggatggagctacgctctttgcgaccgtaggc
tacatgacagtctataattactatgtgtacccagacaaaacccggccacgtgtaagtcag
atgctgattttgactccatttcaaggtcaaggccatggtgctcaacttcttgaaacagtt
catagatactacactgaatttcctacagttcttgatattacagcggaagatccatccaaa
agctatgtgaaattacgagactttgtgcttgtgaagctttgtcaagatttgccctgtttt
tcccgggaaaaattaatgcaaggattcaatgaagatatggtgatagaggcacaacagaag
ttcaaaataaataagcaacacgctagaagggtttatgaaattcttcgactactggtaact
gacatgagtgatgccgaacaatacagaagctacagactggatattaaaagaagactaatt
agcccatataagaaaaagcagagagatcttgctaagatgagaaaatgtctcagaccagaa
gaactgacaaaccagatgaaccaaatagaaataagcatgcaacatgaacagctggaagag
agttttcaggaactagtggaagattaccggcgtgttattgaacgacttgctcaagagtaa

DBGET integrated database retrieval system