KEGG   Homo sapiens (human): 8555
Entry
8555              CDS       T01001                                 
Symbol
CDC14B, CDC14B3, Cdc14B1, Cdc14B2, hCDC14B
Name
(RefSeq) cell division cycle 14B
  KO
K06639  cell division cycle 14 [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    8555 (CDC14B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    8555 (CDC14B)
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    8555 (CDC14B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     8555 (CDC14B)
    3.1.3.48  protein-tyrosine-phosphatase
     8555 (CDC14B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   CDC14
    8555 (CDC14B)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   8555 (CDC14B)
SSDB
Motif
Pfam: DSPn DSPc PTPlike_phytase Y_phosphatase Y_phosphatase3 CDKN3
Other DBs
NCBI-GeneID: 8555
NCBI-ProteinID: NP_201588
OMIM: 603505
HGNC: 1719
Ensembl: ENSG00000081377
Vega: OTTHUMG00000020300
Pharos: O60729(Tbio)
UniProt: O60729
Structure
LinkDB
Position
9:complement(96490939..96619843)
AA seq 498 aa
MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAI
LYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVH
FTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLL
DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY
HQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVKEFL
DICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIGPQQQFL
VMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDD
EINGVTQGDRLRALKSRRQSKTNAIPLTVILQSSVQSCKTSEPNISGSAGITKRTTRSAS
RKSSVKSLSISRTKTVLR
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgaagcggaaaagcgagcggcggtcgagctgggccgccgcgcccccctgctcgcggcgc
tgctcgtcgacctcgccgggtgtgaagaagatccgcagctccacgcagcaagacccgcgc
cgccgggacccccaggacgacgtgtacctggacatcaccgatcgcctttgttttgccatt
ctctacagcagaccaaagagtgcatcaaatgtacattatttcagcatagataatgaactt
gaatatgagaacttctacgcagattttggaccactcaatctggcaatggtttacagatat
tgttgcaagatcaataagaaattaaagtccattacaatgttaaggaagaaaattgttcat
tttactggctctgatcagagaaaacaagcaaatgctgccttccttgttggatgctacatg
gttatatatttggggagaaccccagaagaagcatatagaatattaatctttggagagaca
tcctatattcctttcagagatgctgcctatggaagttgcaatttctacattacacttctt
gactgttttcatgcagtaaagaaggcaatgcagtatggcttccttaatttcaactcattt
aaccttgatgaatatgaacactatgaaaaagcagaaaatggagatttaaattggataata
ccagaccgatttattgccttctgtggacctcattcaagagccagacttgaaagtggttac
caccaacattctcctgagacttatattcaatattttaagaatcacaatgttactaccatt
attcgtctgaataaaaggatgtatgatgccaaacgctttacggatgctggcttcgatcac
catgatcttttctttgcggatggcagcacccctactgatgccattgtcaaagaattccta
gatatctgtgaaaatgctgagggtgccattgcagtacattgcaaagctggccttggtcgc
acgggcactctgatagcctgctacatcatgaagcattacaggatgacagcagccgagacc
attgcgtgggtcaggatctgcagacctggctcggtgattgggcctcagcagcagtttttg
gtgatgaagcaaaccaacctctggctggaaggggactattttcgtcagaagttaaagggg
caggagaatggacaacacagagcagccttctccaaacttctctctggcgttgatgacatt
tccataaatggggtcgagaatcaagatcagcaagaacccgaaccgtacagtgatgatgac
gaaatcaatggagtgacacaaggtgatagacttcgggccttgaaaagcagaagacaatcc
aaaacaaacgctattcctctcacagtaattcttcaatccagtgttcagagctgtaaaaca
tctgaacctaacatttctggcagtgcaggcattactaaaagaaccaccagatctgcttca
aggaaaagcagtgttaaaagtctctccatttcaaggactaaaacagtcttgcgttaa

KEGG   Homo sapiens (human): 8556
Entry
8556              CDS       T01001                                 
Symbol
CDC14A, DFNB105, DFNB32, DFNB35, cdc14, hCDC14
Name
(RefSeq) cell division cycle 14A
  KO
K06639  cell division cycle 14 [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Disease
H00605  Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    8556 (CDC14A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    8556 (CDC14A)
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    8556 (CDC14A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     8556 (CDC14A)
    3.1.3.48  protein-tyrosine-phosphatase
     8556 (CDC14A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   CDC14
    8556 (CDC14A)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   8556 (CDC14A)
SSDB
Motif
Pfam: DSPn DSPc PTPlike_phytase Y_phosphatase Y_phosphatase3 Pentaxin
Other DBs
NCBI-GeneID: 8556
NCBI-ProteinID: NP_003663
OMIM: 603504
HGNC: 1718
Ensembl: ENSG00000079335
Vega: OTTHUMG00000010987
Pharos: Q9UNH5(Tbio)
UniProt: Q9UNH5 Q59EF4
LinkDB
Position
1:100345001..100520277
AA seq 594 aa
MAAESGELIGACEFMKDRLYFATLRNRPKSTVNTHYFSIDEELVYENFYADFGPLNLAMV
YRYCCKLNKKLKSYSLSRKKIVHYTCFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLS
GSNPPYLPFRDASFGNCTYNLTILDCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDF
NWIVPGKFLAFSGPHPKSKIENGYPLHAPEAYFPYFKKHNVTAVVRLNKKIYEAKRFTDA
GFEHYDLFFIDGSTPSDNIVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFT
HAEIIAWIRICRPGSIIGPQQHFLEEKQASLWVQGDIFRSKLKNRPSSEGSINKILSGLD
DMSIGGNLSKTQNMERFGEDNLEDDDVEMKNGITQGDKLRALKSQRQPRTSPSCAFRSDD
TKGHPRAVSQPFRLSSSLQGSAVTLKTSKMALSPSATAKRINRTSLSSGATVRSFSINSR
LASSLGNLNAATDDPENKKTSSSSKAGFTASPFTNLLNGSSQPTTRNYPELNNNQYNRSS
NSNGGNLNSPPGPHSAKTEEHTTILRPSYTGLSSSSARFLSRSIPSLQSEYVHY
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggcagcggagtcaggggaactaatcggggcttgtgagttcatgaaagatcggttatat
tttgctactttaaggaatagaccaaaaagcacagtaaatacccactatttctccatcgat
gaggagctggtctatgaaaatttctatgcagattttggaccgctgaacttggcaatggtg
tacagatattgctgcaaactaaacaagaaactaaaatcatacagtttgtcaagaaagaaa
atagtgcactacacctgttttgaccaacggaaaagagcaaatgcagcatttttgataggt
gcctatgcagtaatctatttaaagaagacaccagaagaagcctacagagcactcctgtct
ggctcaaaccccccctatcttccattcagggatgcttcctttggaaattgcacttacaat
ctcaccattctcgactgtttgcagggaatcagaaagggattacaacatggattttttgac
tttgagacatttgatgtggatgaatatgaacattatgagcgagttgaaaatggtgacttc
aactggattgttccaggaaaatttttagcatttagtggaccacatcctaaaagcaaaatt
gagaatggttatcctcttcacgcccctgaagcctactttccttatttcaaaaagcataat
gtgactgcagttgtgaggctaaacaaaaagatttatgaggcaaagcgcttcacagacgct
ggcttcgagcactatgacctcttcttcatagatggcagcacacccagtgacaacatcgtg
cgaaggttcctgaacatctgtgagaacaccgaaggggccatcgccgttcactgcaaagct
ggtcttggaagaacagggacattgatagcctgttatgtaatgaaacactacaggtttaca
catgctgaaataattgcttggattagaatatgccggccaggctctattataggaccccag
cagcacttcctggaagaaaaacaagcatcgttgtgggtccaaggagacattttccgatcc
aaactgaaaaatcgaccatccagtgaaggaagtattaataaaattctttctggcctagat
gatatgtctattggtggaaatctttcaaaaacacaaaacatggaacgatttggagaggat
aacttagaagatgatgatgtggaaatgaaaaatggtataacccagggagacaaactacgt
gccttaaaaagtcagagacagccacgtacctcaccatcctgtgcatttaggtcagatgat
acaaaaggacatccaagagcagtgtcccagcctttcagattaagttcatccctgcaagga
tctgcagttactttgaagacatcaaaaatggcactgtccccttcagcaacggccaagagg
atcaacagaacttctttgtcttcgggtgccactgtaagaagcttttccataaactcccgg
ctagccagttctctagggaacttgaatgctgcaacagatgatccagagaacaaaaagacc
tcctcatcctctaaggcaggcttcacagccagcccgtttaccaacctcttgaatggcagc
tcccagccaactaccagaaattaccctgagctcaacaataatcagtacaacagaagcagc
aacagcaacgggggcaacctgaacagccccccaggcccccacagcgccaagacagaggag
cacaccaccatcctccgaccctcctacaccgggctttcttcttcttcagcgagattcctg
agccgttctatcccttcccttcagtctgaatatgttcattactaa

DBGET integrated database retrieval system