KEGG   Homo sapiens (human): 8559
Entry
8559              CDS       T01001                                 
Symbol
PRPF18, PRP18, hPrp18
Name
(RefSeq) pre-mRNA processing factor 18
  KO
K12817  pre-mRNA-splicing factor 18
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    8559 (PRPF18)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    8559 (PRPF18)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   Step II factors
    8559 (PRPF18)
SSDB
Motif
Pfam: Prp18 PRP4
Other DBs
NCBI-GeneID: 8559
NCBI-ProteinID: NP_003666
OMIM: 604993
HGNC: 17351
Ensembl: ENSG00000165630
Pharos: Q99633(Tbio)
UniProt: Q99633
Structure
LinkDB
Position
10:13586965..13655929
AA seq 342 aa
MDILKSEILRKRQLVEDRNLLVENKKYFKRSELAKKEEEAYFERCGYKIQPKEEDQKPLT
SSNPVLELELAEEKLPMTLSRQEVIRRLRERGEPIRLFGETDYDAFQRLRKIEILTPEVN
KGLRNDLKAALDKIDQQYLNEIVGGQEPGEEDTQNDLKVHEENTTIEELEALGESLGKGD
DHKDMDIITKFLKFLLGVWAKELNAREDYVKRSVQGKLNSATQKQTESYLRPLFRKLRKR
NLPADIKESITDIIKFMLQREYVKANDAYLQMAIGNAPWPIGVTMVGIHARTGREKIFSK
HVAHVLNDETQRKYIQGLKRLMTICQKHFPTDPSKCVEYNAL
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggacattctgaaatcagagatccttcggaagcggcagctggtggaggacaggaacctg
ctggtggaaaataaaaaatatttcaagcgtagtgagctcgccaaaaaagaagaggaagca
tattttgaaagatgtggctacaagatacagccaaaagaggaggaccagaaaccattaact
tcatcgaatccagtgttagaacttgaactggcagaggaaaaattacctatgacgctttct
aggcaagaggtcatcagaagattgagagaaagaggagaaccaatcagactatttggagag
actgattatgatgcttttcaacgtttaaggaaaatagagatcctcacaccagaagttaac
aagggattgaggaatgatttgaaagcagccttggataagattgatcagcagtacctcaat
gaaatcgtcggcggtcaggagcctggagaggaagacacacagaatgatctgaaagttcat
gaggaaaacaccacaattgaagagttagaggcgcttggagagtccttagggaaaggcgat
gatcataaagacatggacatcatcaccaaattcctgaagtttcttcttggcgtttgggct
aaagaattgaatgccagagaagattatgtgaaacgcagtgtgcagggtaaactgaacagt
gcgacccagaaacagaccgagtcctacctaagaccactttttagaaagctacggaaaagg
aatcttcctgctgatattaaagaatcaataacggatattattaaattcatgttgcagaga
gaatacgtgaaggcaaatgatgcttatcttcagatggccattggaaatgcgccttggccc
atcggtgtcactatggttggtatccatgccagaactggcagagaaaagattttttccaag
catgttgcacatgttttaaatgacgaaactcagcggaaatatattcagggattgaagagg
ttaatgaccatttgccagaaacactttcctacagacccatccaaatgtgtggagtacaat
gcactgtga

DBGET integrated database retrieval system