KEGG   Homo sapiens (human): 866Help
Entry
866               CDS       T01001                                 

Gene name
SERPINA6, CBG
Definition
(RefSeq) serpin family A member 6
  KO
K04525  serpin peptidase inhibitor, clade A
Organism
hsa  Homo sapiens (human)
Network
N00313  Transport of cortisol
N00314  Mutation-inactivated CBG to transport of cortisol
Disease
H01163  Corticosteroid-binding globulin (CBG) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    866 (SERPINA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin
Motif
Other DBs
NCBI-GeneID: 866
NCBI-ProteinID: NP_001747
OMIM: 122500
HGNC: 1540
Ensembl: ENSG00000170099
Vega: OTTHUMG00000171346
Pharos: P08185(Tbio)
UniProt: P08185 A0A2Z4LCH4
LinkDB All DBs
Structure
PDB: 

Position
14q32.13
AA seq 405 aa AA seqDB search
MPLLLYTCLLWLPTSGLWTVQAMDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPK
KNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSD
TSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQG
KIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTI
SYLHDAELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLY
IPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDT
AGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgccactcctcctgtacacctgtcttctctggctgcccaccagcggcctctggaccgtc
caggccatggatcctaacgctgcttatgtgaacatgagtaaccatcaccggggcctggct
tcagccaacgttgactttgccttcagcctgtataagcacctagtggccttgagtcccaaa
aagaacattttcatctcccctgtgagcatctccatggccttagctatgctgtccctgggc
acctgtggccacacacgggcccagcttctccagggcctgggtttcaacctcactgagagg
tctgagactgagatccaccagggtttccagcacctgcaccaactctttgcaaagtcagac
accagcttagaaatgaccatgggcaatgccttgtttcttgatggcagcctggagttgctg
gagtcattctcagcagacatcaagcactactatgagtcagaggtcttggctatgaatttc
caggactgggcaacagccagcagacagatcaacagctatgtcaagaataagacacagggg
aaaattgtcgacttgttttcagggctggatagcccagccatcctcgtcctggtcaactat
atcttcttcaaaggcacatggacacagccctttgacctggcaagcaccagggaggagaac
ttctatgtggacgagacaactgtggtgaaggtgcccatgatgttgcagtcgagcaccatc
agttaccttcatgacgcggagctcccctgccagctggtgcagatgaactacgtgggcaat
gggactgtcttcttcatccttccggacaaggggaagatgaacacagtcatcgctgcactg
agccgggacacgattaacaggtggtccgcaggcctgaccagcagccaggtggacctgtac
attccaaaggtcaccatctctggagtctatgacctcggagatgtgctggaggaaatgggc
attgcagacttgttcaccaaccaggcaaatttctcacgcatcacccaggacgcccagctg
aagtcatcaaaggtggtccataaagctgtgctgcaactcaatgaggagggtgtggacaca
gctggctccactggggtcaccctaaacctgacgtccaagcctatcatcttgcgtttcaac
cagcccttcatcatcatgatcttcgaccacttcacctggagcagccttttcctggcgagg
gttatgaacccagtgtaa

DBGET integrated database retrieval system