KEGG   Homo sapiens (human): 87769
Entry
87769             CDS       T01001                                 
Symbol
GGACT, A2LD1
Name
(RefSeq) gamma-glutamylamine cyclotransferase
  KO
K19761  gamma-glutamylaminecyclotransferase [EC:2.3.2.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    87769 (GGACT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-
     87769 (GGACT)
SSDB
Motif
Pfam: GGACT AIG2_2
Other DBs
NCBI-GeneID: 87769
NCBI-ProteinID: NP_001182016
OMIM: 613378
HGNC: 25100
Ensembl: ENSG00000134864
Pharos: Q9BVM4(Tbio)
UniProt: Q9BVM4
Structure
LinkDB
Position
13:complement(100530180..100588789)
AA seq 153 aa
MALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSG
RLVEGEVYAVDERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEEPPAPTAVQCFVYS
RATFPPEWAQLPHHDSYDSEGPHGLRYNPRENR
NT seq 462 nt   +upstreamnt  +downstreamnt
atggccctagtcttcgtgtacggcaccctgaagcggggtcagcccaaccacagggtcctg
cgggacggcgcccacggctccgcagcctttcgggcgcgcggccgcacgctggagccctac
ccgttggtgatcgcgggggagcacaacatcccgtggctgctgcacctgcccggctcgggg
cgcctcgtggagggcgaggtctacgcggtagacgagcggatgctgcgctttctggatgac
ttcgagagttgcccggccctgtaccagcgcacggtgctgcgggtacagctgctggaggac
cgggccccgggcgcagaggagccgccagcgcccaccgcggtgcagtgcttcgtgtacagc
agggccaccttcccgccggagtgggcccagctcccgcaccatgacagctacgactccgag
gggccgcacgggctgcgctacaacccccgggagaacagataa

DBGET integrated database retrieval system