KEGG   Homo sapiens (human): 8799
Entry
8799              CDS       T01001                                 
Symbol
PEX11B, PEX11-BETA, PEX11beta, PEX14B
Name
(RefSeq) peroxisomal biogenesis factor 11 beta
  KO
K13352  peroxin-11B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Disease
H00177  Neonatal adrenoleukodystrophy
H00205  Peroxisome biogenesis disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    8799 (PEX11B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    8799 (PEX11B)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   8799 (PEX11B)
SSDB
Motif
Pfam: PEX11 TPR_2
Other DBs
NCBI-GeneID: 8799
NCBI-ProteinID: NP_003837
OMIM: 603867
HGNC: 8853
Ensembl: ENSG00000131779
Pharos: O96011(Tbio)
UniProt: O96011 A0A024R4E7
LinkDB
Position
1:complement(145911348..145918717)
AA seq 259 aa
MDAWVRFSAQSQARERLCRAAQYACSLLGHALQRHGASPELQKQIRQLESHLSLGRKLLR
LGNSADALESAKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWA
QRSFRYYLFSLIMNLSRDAYEIRLLMEQESSACSRRLKGSGGGVPGGSETGGLGGPGTPG
GGLPQLALKLRLQVLLLARVLRGHPPLLLDVVRNACDLFIPLDKLGLWRCGPGIVGLCGL
VSSILSILTLIYPWLRLKP
NT seq 780 nt   +upstreamnt  +downstreamnt
atggacgcctgggtccgcttcagtgctcagagccaagcccgggagcggctgtgtagggcc
gcccagtatgcttgctctcttcttggccatgcgctgcagaggcatggagccagtcctgag
ttacagaaacagattcgacaactggagagccacctgagccttggaagaaagcttctacgc
ctgggtaactcagcagatgcccttgagtcagccaaaagagctgttcacctatcagatgtt
gtcctgagattctgcatcactgttagtcacctcaatcgagccttgtacttcgcctgtgac
aatgtcctgtgggctggaaagtctggactggctccccgtgtggatcaggagaagtgggcc
cagcgttcattcaggtactatttgttttccctcatcatgaatttgagccgtgatgcttat
gagattcgcctactgatggagcaagagtcttctgcttgtagccggcgactgaaaggttct
ggaggaggagtcccaggaggaagtgaaactgggggacttgggggaccagggactccagga
ggaggtctgccccaactggctctgaaacttcggctgcaagtcctgctcctggctcgagtc
cttagaggtcatcccccacttctgctagacgtggtcagaaatgcctgtgatctcttcatt
cctctggacaaactaggcctctggcgctgtggccctgggattgtggggctttgtggcctc
gtgtcctccatcctgtctattctcaccctaatctatccctggctacgactcaagccctga

KEGG   Homo sapiens (human): 8800
Entry
8800              CDS       T01001                                 
Symbol
PEX11A, PEX11-ALPHA, PEX11alpha, PMP28, hsPEX11p
Name
(RefSeq) peroxisomal biogenesis factor 11 alpha
  KO
K13351  peroxin-11A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    8800 (PEX11A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    8800 (PEX11A)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   8800 (PEX11A)
SSDB
Motif
Pfam: PEX11 Adaptin_N
Other DBs
NCBI-GeneID: 8800
NCBI-ProteinID: NP_003838
OMIM: 603866
HGNC: 8852
Ensembl: ENSG00000166821
Pharos: O75192(Tbio)
UniProt: O75192 B2R8C6
LinkDB
Position
15:complement(89681535..89690754)
AA seq 247 aa
MDAFTRFTNQTQGRDRLFRATQYTCMLLRYLLEPKAGKEKVVMKLKKLESSVSTGRKWFR
LGNVVHAIQATEQSIHATDLVPRLCLTLANLNRVIYFICDTILWVRSVGLTSGINKEKWR
TRAAHHYYYSLLLSLVRDLYEISLQMKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSF
LLLLFRSLKQHPPLLLDTVKNLCDILNPLDQLGIYKSNPGIIGLGGLVSSIAGMITVAYP
QMKLKTR
NT seq 744 nt   +upstreamnt  +downstreamnt
atggacgccttcacccgcttcaccaaccagacccagggccgggaccgactcttcagagcc
actcagtacacatgcatgttgcttagatatttgttagagcccaaagctggcaaagagaag
gtggtaatgaagctcaagaaactggagtccagtgtgagcactggtcgtaaatggttcaga
ctaggcaatgtggtacatgctatacaggcaactgagcagagcattcatgccactgacctg
gtacctcgcttatgcttaacattagccaacctgaaccgtgtgatttatttcatctgtgac
accatcctctgggtgaggagcgtaggtctcacctctggcatcaacaaagagaaatggcga
acgagggctgctcaccactactactattctcttctgctgagcctggtcagggatctgtat
gaaatctccctgcagatgaaacgagttacatgtgacagggcaaagaaagagaaatcagca
tcccaggatcctctttggttcagcgtggctgaggaggaaacagaatggctccaatccttt
ctacttcttttattccgatctctgaagcagcatcctcccttgctcctggacacagtgaag
aacctttgtgatatcctgaaccctttggaccagctggggatctataaatccaatcctggc
atcattggacttggaggtcttgtgtcctctatagcaggcatgatcactgtggcatatcct
cagatgaagctgaagacccgttag

KEGG   Homo sapiens (human): 92960
Entry
92960             CDS       T01001                                 
Symbol
PEX11G, PEX11gamma
Name
(RefSeq) peroxisomal biogenesis factor 11 gamma
  KO
K13353  peroxin-11C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    92960 (PEX11G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    92960 (PEX11G)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   92960 (PEX11G)
SSDB
Motif
Pfam: PEX11
Other DBs
NCBI-GeneID: 92960
NCBI-ProteinID: NP_542393
OMIM: 607583
HGNC: 20208
Ensembl: ENSG00000104883
Pharos: Q96HA9(Tbio)
UniProt: Q96HA9
LinkDB
Position
19:complement(7476875..7494977)
AA seq 241 aa
MASLSGLASALESYRGRDRLIRVLGYCCQLVGGVLVEQCPARSEVGTRLLVVSTQLSHCR
TILRLFDDLAMFVYTKQYGLGAQEEDAFVRCVSVLGNLADQLYYPCEHVAWAADARVLHV
DSSRWWTLSTTLWALSLLLGVARSLWMLLKLRQRLRSPTAPFTSPLPRGKRRAMEAQMQS
EALSLLSNLADLANAVHWLPRGVLWAGRFPPWLVGLMGTISSILSMYQAARAGGQAEATT
P
NT seq 726 nt   +upstreamnt  +downstreamnt
atggcgtcgctgagcggcctggcgtcggcgctggagtcgtacaggggccgggaccgcctg
atccgagtgctggggtactgctgccagctggttggtggagttctggttgaacagtgtccc
gccaggtccgaagtggggacacgtctgttggtggtgtccacccaactcagccactgcagg
accatcttgcgactctttgatgacctggccatgtttgtctacactaagcaatatggcctg
ggggcacaggaggaggacgcctttgtccgctgtgtctccgtcctagggaacctggctgac
cagctctactacccctgtgagcacgtggcctgggcggctgatgcccgggtcctccacgtg
gactcttctcggtggtggacgctgagtacaaccctgtgggccctctctctgctcctgggg
gttgccaggtccctgtggatgctgctgaaactgagacagaggctgcggagccccacggcg
cccttcaccagcccgctgccccggggcaagcggagggccatggaggcgcagatgcagtcg
gaggcgctgtcacttctcagcaacctggccgacctggccaacgccgtgcactggctgccc
cggggcgtgctgtgggccggccgcttcccgccgtggctagtgggcctcatgggcaccatc
tcctcaatcctcagcatgtaccaggcggcccgggccggcggccaggccgaggccactacc
ccctga

DBGET integrated database retrieval system