KEGG   Homo sapiens (human): 8808
Entry
8808              CDS       T01001                                 
Symbol
IL1RL2, IL-1Rrp2, IL-36R, IL1R-rp2, IL1RRP2
Name
(RefSeq) interleukin 1 receptor like 2
  KO
K05172  interleukin 1 receptor-like 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Drug target
Imsidolimab: D11892
Spesolimab: D12066<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8808 (IL1RL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    8808 (IL1RL2)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL1 receptor family
   8808 (IL1RL2)
SSDB
Motif
Pfam: TIR Ig_2 Ig_3 I-set V-set ig Ig_6 Ig_4 TIR_2
Other DBs
NCBI-GeneID: 8808
NCBI-ProteinID: NP_003845
OMIM: 604512
HGNC: 5999
Ensembl: ENSG00000115598
Pharos: Q9HB29(Tbio)
UniProt: Q9HB29
Structure
LinkDB
Position
2:102186973..102243086
AA seq 575 aa
MWSLLLCGLSIALPLSVTADGCKDIFMKNEILSASQPFAFNCTFPPITSGEVSVTWYKNS
SKIPVSKIIQSRIHQDETWILFLPMEWGDSGVYQCVIKGRDSCHRIHVNLTVFEKHWCDT
SIGGLPNLSDEYKQILHLGKDDSLTCHLHFPKSCVLGPIKWYKDCNEIKGERFTVLETRL
LVSNVSAEDRGNYACQAILTHSGKQYEVLNGITVSITERAGYGGSVPKIIYPKNHSIEVQ
LGTTLIVDCNVTDTKDNTNLRCWRVNNTLVDDYYDESKRIREGVETHVSFREHNLYTVNI
TFLEVKMEDYGLPFMCHAGVSTAYIILQLPAPDFRAYLIGGLIALVAVAVSVVYIYNIFK
IDIVLWYRSAFHSTETIVDGKLYDAYVLYPKPHKESQRHAVDALVLNILPEVLERQCGYK
LFIFGRDEFPGQAVANVIDENVKLCRRLIVIVVPESLGFGLLKNLSEEQIAVYSALIQDG
MKVILIELEKIEDYTVMPESIQYIKQKHGAIRWHGDFTEQSQCMKTKFWKTVRYHMPPRR
CRPFPPVQLLQHTPCYRTAGPELGSRRKKCTLTTG
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgtggtccttgctgctctgcgggttgtccatcgcccttccactgtctgtcacagcagat
ggatgcaaggacatttttatgaaaaatgagatactttcagcaagccagccttttgctttt
aattgtacattccctcccataacatctggggaagtcagtgtaacatggtataaaaattct
agcaaaatcccagtgtccaaaatcatacagtctagaattcaccaggacgagacttggatt
ttgtttctccccatggaatggggggactcaggagtctaccaatgtgttataaagggtaga
gacagctgtcatagaatacatgtaaacctaactgtttttgaaaaacattggtgtgacact
tccataggtggtttaccaaatttatcagatgagtacaagcaaatattacatcttggaaaa
gatgatagtctcacatgtcatctgcacttcccgaagagttgtgttttgggtccaataaag
tggtataaggactgtaacgagattaaaggggagcggttcactgttttggaaaccaggctt
ttggtgagcaatgtctcggcagaggacagagggaactacgcgtgtcaagccatactgaca
cactcagggaagcagtacgaggttttaaatggcatcactgtgagcattacagaaagagct
ggatatggaggaagtgtccctaaaatcatttatccaaaaaatcattcaattgaagtacag
cttggtaccactctgattgtggactgcaatgtaacagacaccaaggataatacaaatcta
cgatgctggagagtcaataacactttggtggatgattactatgatgaatccaaacgaatc
agagaaggggtggaaacccatgtctcttttcgggaacataatttgtacacagtaaacatc
accttcttggaagtgaaaatggaagattatggccttcctttcatgtgccacgctggagtg
tccacagcatacattatattacagctcccagctccggattttcgagcttacttgatagga
gggcttatcgccttggtggctgtggctgtgtctgttgtgtacatatacaacatttttaag
atcgacattgttctttggtatcgaagtgccttccattctacagagaccatagtagatggg
aagctgtatgacgcctatgtcttataccccaagccccacaaggaaagccagaggcatgcc
gtggatgccctggtgttgaatatcctgcccgaggtgttggagagacaatgtggatataag
ttgtttatattcggcagagatgaattccctggacaagccgtggccaatgtcatcgatgaa
aacgttaagctgtgcaggaggctgattgtcattgtggtccccgaatcgctgggctttggc
ctgttgaagaacctgtcagaagaacaaatcgcggtctacagtgccctgatccaggacggg
atgaaggttattctcattgagctggagaaaatcgaggactacacagtcatgccagagtca
attcagtacatcaaacagaagcatggtgccatccggtggcatggggacttcacggagcag
tcacagtgtatgaagaccaagttttggaagacagtgagataccacatgccgcccagaagg
tgtcggccgtttcctccggtccagctgctgcagcacacaccttgctaccgcaccgcaggc
ccagaactaggctcaagaagaaagaagtgtactctcacgactggctaa

DBGET integrated database retrieval system