KEGG   Homo sapiens (human): 8840
Entry
8840              CDS       T01001                                 
Symbol
CCN4, WISP1, WISP1-OT1, WISP1-UT1, WISP1c, WISP1i, WISP1tc
Name
(RefSeq) cellular communication network factor 4
  KO
K22471  CCN family member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    8840 (CCN4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8840 (CCN4)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    8840 (CCN4)
SSDB
Motif
Pfam: TSP1_CCN IGFBP VWC Cys_knot TSP_1
Other DBs
NCBI-GeneID: 8840
NCBI-ProteinID: NP_003873
OMIM: 603398
HGNC: 12769
Ensembl: ENSG00000104415
Pharos: O95388(Tbio)
UniProt: O95388
LinkDB
Position
8:133191039..133231690
AA seq 367 aa
MRWFLPWTLAAVTAAAASTVLATALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPP
RCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCAQVVG
VGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCC
EQWVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTSCGLGVSTRISN
VNAQCWPEQESRLCNLRPCDVDIHTLIKAGKKCLAVYQPEASMNFTLAGCISTRSYQPKY
CGVCMDNRCCIPYKSKTIDVSFQCPDGLGFSRQVLWINACFCNLSCRNPNDIFADLESYP
DFSEIAN
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgaggtggttcctgccctggacgctggcagcagtgacagcagcagccgccagcaccgtc
ctggccacggccctctctccagcccctacgaccatggactttaccccagctccactggag
gacacctcctcacgcccccaattctgcaagtggccatgtgagtgcccgccatccccaccc
cgctgcccgctgggggtcagcctcatcacagatggctgtgagtgctgtaagatgtgcgct
cagcagcttggggacaactgcacggaggctgccatctgtgacccccaccggggcctctac
tgtgactacagcggggaccgcccgaggtacgcaataggagtgtgtgcacaggtggtcggt
gtgggctgcgtcctggatggggtgcgctacaacaacggccagtccttccagcctaactgc
aagtacaactgcacgtgcatcgacggcgcggtgggctgcacaccactgtgcctccgagtg
cgccccccgcgtctctggtgcccccacccgcggcgcgtgagcatacctggccactgctgt
gagcagtgggtatgtgaggacgacgccaagaggccacgcaagaccgcaccccgtgacaca
ggagccttcgatgctgtgggtgaggtggaggcatggcacaggaactgcatagcctacaca
agcccctggagcccttgctccaccagctgcggcctgggggtctccactcggatctccaat
gttaacgcccagtgctggcctgagcaagagagccgcctctgcaacttgcggccatgcgat
gtggacatccatacactcattaaggcagggaagaagtgtctggctgtgtaccagccagag
gcatccatgaacttcacacttgcgggctgcatcagcacacgctcctatcaacccaagtac
tgtggagtttgcatggacaataggtgctgcatcccctacaagtctaagactatcgacgtg
tccttccagtgtcctgatgggcttggcttctcccgccaggtcctatggattaatgcctgc
ttctgtaacctgagctgtaggaatcccaatgacatctttgctgacttggaatcctaccct
gacttctcagaaattgccaactag

DBGET integrated database retrieval system