Homo sapiens (human): 9083 Help Entry 9083              CDS       T01001                                  Symbol BPY2, BPY2A, VCY2, VCY2A Name (RefSeq) basic charge Y-linked 2   KO K26999   testis-specific basic protein Y 2 Organism hsa  Homo sapiens (human) Disease H02534   Y-linked spermatogenic failure Brite KEGG Orthology (KO) [BR:hsa00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hsa03037]     9083 (BPY2) Cilium and associated proteins [BR:hsa03037]  Motile cilia and associated proteins   Sperm associated proteins    9083 (BPY2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  9083 NCBI-ProteinID:  NP_004669 OMIM:  400013 HGNC:  13508 Ensembl:  ENSG00000183753 UniProt:  O14599 LinkDB All DBs Position Y:22984263..23005465 Genome browser AA seq 106 aa AA seqDB search MMTLVPRARTRAGQDHYSHPCPRFSQVLLTEGIMTYCLTKNLSDVNILHRLLKNGNVRNT LLQSKVGLLTYYVKLYPGEVTLLTRPSIQMRLCCITGSVSRPRSQK NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgatgacgcttgtccccagagccaggacacgtgcaggacaggatcattactctcatccc tgccccagattttcacaggtgctgcttacagagggcatcatgacatattgcttgacaaag aacctaagtgatgttaatattctgcataggttgctaaaaaatgggaatgtgagaaatacc ttgcttcagtccaaagtgggcttgctgacatattatgtgaaactgtacccgggtgaagtg actcttctgactaggcccagcatacaaatgagattatgctgtatcactggctcagtgtcg aggcccagatcacagaagtaa

DBGET integrated database retrieval system