KEGG   Homo sapiens (human): 9123
Entry
9123              CDS       T01001                                 
Symbol
SLC16A3, MCT_3, MCT_4, MCT-3, MCT-4, MCT3, MCT4
Name
(RefSeq) solute carrier family 16 member 3
  KO
K08180  MFS transporter, MCT family, solute carrier family 16 (monocarboxylic acid transporters), member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    9123 (SLC16A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9123 (SLC16A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC16: Monocarboxylate transporter
   9123 (SLC16A3)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Monocarboxylate transporter (MCT) family [TC:2.A.1.13]
    9123 (SLC16A3)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 9123
NCBI-ProteinID: NP_001035887
OMIM: 603877
HGNC: 10924
Ensembl: ENSG00000141526
Pharos: O15427(Tchem)
UniProt: O15427 A0A024R8U1
LinkDB
Position
17:82217934..82240086
AA seq 465 aa
MGGAVVDEGPTGVKAPDGGWGWAVLFGCFVITGFSYAFPKAVSVFFKELIQEFGIGYSDT
AWISSILLAMLYGTGPLCSVCVNRFGCRPVMLVGGLFASLGMVAASFCRSIIQVYLTTGV
ITGLGLALNFQPSLIMLNRYFSKRRPMANGLAAAGSPVFLCALSPLGQLLQDRYGWRGGF
LILGGLLLNCCVCAALMRPLVVTAQPGSGPPRPSRRLLDLSVFRDRGFVLYAVAASVMVL
GLFVPPVFVVSYAKDLGVPDTKAAFLLTILGFIDIFARPAAGFVAGLGKVRPYSVYLFSF
SMFFNGLADLAGSTAGDYGGLVVFCIFFGISYGMVGALQFEVLMAIVGTHKFSSAIGLVL
LMEAVAVLVGPPSGGKLLDATHVYMYVFILAGAEVLTSSLILLLGNFFCIRKKPKEPQPE
VAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgggaggggccgtggtggacgagggccccacaggcgtcaaggcccctgacggcggctgg
ggctgggccgtgctcttcggctgtttcgtcatcactggcttctcctacgccttccccaag
gccgtcagtgtcttcttcaaggagctcatacaggagtttgggatcggctacagcgacaca
gcctggatctcctccatcctgctggccatgctctacgggacaggtccgctctgcagtgtg
tgcgtgaaccgctttggctgccggcccgtcatgcttgtggggggtctctttgcgtcgctg
ggcatggtggctgcgtccttttgccggagcatcatccaggtctacctcaccactggggtc
atcacggggttgggtttggcactcaacttccagccctcgctcatcatgctgaaccgctac
ttcagcaagcggcgccccatggccaacgggctggcggcagcaggtagccctgtcttcctg
tgtgccctgagcccgctggggcagctgctgcaggaccgctacggctggcggggcggcttc
ctcatcctgggcggcctgctgctcaactgctgcgtgtgtgccgcactcatgaggcccctg
gtggtcacggcccagccgggctcggggccgccgcgaccctcccggcgcctgctagacctg
agcgtcttccgggaccgcggctttgtgctttacgccgtggccgcctcggtcatggtgctg
gggctcttcgtcccgcccgtgttcgtggtgagctacgccaaggacctgggcgtgcccgac
accaaggccgccttcctgctcaccatcctgggcttcattgacatcttcgcgcggccggcc
gcgggcttcgtggcggggcttgggaaggtgcggccctactccgtctacctcttcagcttc
tccatgttcttcaacggcctcgcggacctggcgggttctacggcgggcgactacggcggc
ctcgtggtcttctgcatcttctttggcatctcctacggcatggtgggggccctgcagttc
gaggtgctcatggccatcgtgggcacccacaagttctccagtgccattggcctggtgctg
ctgatggaggcggtggccgtgctcgtcgggcccccttcgggaggcaaactcctggatgcg
acccacgtctacatgtacgtgttcatcctggcgggggccgaggtgctcacctcctccctg
attttgctgctgggcaacttcttctgcattaggaagaagcccaaagagccacagcctgag
gtggcggccgcggaggaggagaagctccacaagcctcctgcagactcgggggtggacttg
cgggaggtggagcatttcctgaaggctgagcctgagaaaaacggggaggtggttcacacc
ccggaaacaagtgtctga

DBGET integrated database retrieval system