KEGG   Homo sapiens (human): 9146
Entry
9146              CDS       T01001                                 
Symbol
HGS, HRS
Name
(RefSeq) hepatocyte growth factor-regulated tyrosine kinase substrate
  KO
K12182  hepatocyte growth factor-regulated tyrosine kinase substrate
Organism
hsa  Homo sapiens (human)
Pathway
hsa03250  Viral life cycle - HIV-1
hsa04144  Endocytosis
hsa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    9146 (HGS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9146 (HGS)
   04145 Phagosome
    9146 (HGS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9146 (HGS)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    9146 (HGS)
SSDB
Motif
Pfam: VHS Hrs_helical FYVE FYVE_2 UIM
Other DBs
NCBI-GeneID: 9146
NCBI-ProteinID: NP_004703
OMIM: 604375
HGNC: 4897
Ensembl: ENSG00000185359
Pharos: O14964(Tbio)
UniProt: O14964 A0A0S2Z4R4
Structure
LinkDB
Position
17:81684011..81702121
AA seq 777 aa
MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHV
ALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFR
NEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKH
HCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTS
PLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASS
APPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQ
PGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFV
NRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDA
RGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQE
KERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVE
GSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAY
SSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPS
QDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD
NT seq 2334 nt   +upstreamnt  +downstreamnt
atggggcgaggcagcggcaccttcgagcgtctcctagacaaggcgaccagccagctcctg
ttggagacagattgggagtccattttgcagatctgcgacctgatccgccaaggggacaca
caagcaaaatatgctgtgaattccatcaagaagaaagtcaacgacaagaacccacacgtc
gccttgtatgccctggaggtcatggaatctgtggtaaagaactgtggccagacagttcat
gatgaggtggccaacaagcagaccatggaggagctgaaggacctgctgaagagacaagtg
gaggtaaacgtccgtaacaagatcctgtacctgatccaggcctgggcgcatgccttccgg
aacgagcccaagtacaaggtggtccaggacacctaccagatcatgaaggtggaggggcac
gtctttccagaattcaaagagagcgatgccatgtttgctgccgagagagccccagactgg
gtggacgctgaggaatgccaccgctgcagggtgcagttcggggtgatgacccgtaagcac
cactgccgggcgtgtgggcagatattctgtggaaagtgttcttccaagtactccaccatc
cccaagtttggcatcgagaaggaggtgcgcgtgtgtgagccctgctacgagcagctgaac
aggaaagcggagggaaaggccacttccaccactgagctgccccccgagtacctgaccagc
cccctgtctcagcagtcccagctgccccccaagagggacgagacggccctgcaggaggag
gaggagctgcagctggccctggcgctgtcacagtcagaggcggaggagaaggagaggctg
agacagaagtccacgtacacttcgtaccccaaggcggagcccatgccctcggcctcctca
gcgccccccgccagcagcctgtactcttcacctgtgaactcgtcggcgcctctggctgag
gacatcgaccctgagctcgcacggtatctcaaccggaactactgggagaagaagcaggag
gaggctcgcaagagccccacgccatctgcgcccgtgcccctgacggagccggctgcacag
cctggggaagggcacgcagcccccaccaacgtggtggagaaccccctcccggagacagac
tctcagcccattcctccctctggtggcccctttagtgagccacagttccacaatggcgag
tctgaggagagccacgagcagttcctgaaggcgctgcagaacgccgtcaccaccttcgtg
aaccgcatgaagagtaaccacatgcggggccgcagcatcaccaatgactcggccgtgctc
tcactcttccagtccatcaacggcatgcacccgcagctgctggagctgctcaaccagctg
gacgagcgcaggctgtactatgaggggctgcaggacaagctggcacagatccgcgatgcc
cggggggcgctgagtgccctgcgcgaagagcaccgggagaagcttcgccgggcagccgag
gaggcagagcgccagcgccagatccagctggcccagaagctggagataatgcggcagaag
aagcaggagtacctggaggtgcagaggcagctggccatccagcgcctgcaggagcaggag
aaggagcggcagatgcggctggagcagcagaagcagacggtccagatgcgcgcgcagatg
cccgccttccccctgccctacgcccagctccaggccatgcccgcagccggaggtgtgctc
taccagccctcgggaccagccagcttccccagcaccttcagccctgccggctcggtggag
ggctccccaatgcacggcgtgtacatgagccagccggcccctgccgctggcccctacccc
agcatgcccagcactgcggctgatcccagcatggtgagtgcctacatgtacccagcaggg
gccactggggcgcaggcggccccccaggcccaggccggacccaccgccagccccgcttac
tcatcctaccagcctactcccacagcgggctaccagaacgtggcctcccaggccccacag
agcctcccggccatctctcagcctccgcagtccagcaccatgggctacatggggagccag
tcagtctccatgggctaccagccttacaacatgcagaatctcatgaccaccctcccaagc
caggatgcgtctctgccaccccagcagccctacatcgcggggcagcagcccatgtaccag
cagatggcaccctctggcggtcccccccagcagcagccccccgtggcccagcaaccgcag
gcacaggggccgccggcacagggcagcgaggcccagctcatttcattcgactga

DBGET integrated database retrieval system